Identifiers and Description

Gene Model Identifier

Contig14864.0.g42

Standard Name

None

Aliases

Contig14864_0_g42

Description

DNA mismatch repair protein, C-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam01119 ) DNA mismatch repair protein, C-terminal domain
  • ( pfam13589 ) Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
  • ( pfam02518 ) Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYMR167W1.9996609186508915e-82MLH1 SGDID:S000004777, Chr XII
I from 594886-597195, Gen...
T. thermophilaTTHERM_001270004.000904604388404e-59DNA mismatch repair protein, C
-terminal domai...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14864.0.g42(coding)
ATGAACTAAGACATGAAAGATGAAAGTCAAGTTCCCTCTATCAGAAAGCTTGATGAAGCT
ACAATCAATAAAATTGCTGCTGGAGAAGTGGTAGTCTCCCCTTCTGCCGCTTTGAAAGAA
ATGATTGAAAACTCAATAGATGCCGGAGCTTCTAGAATTGATGTACTTTGTCAGAAGAGT
GGCTTTGATTTTATGCAAATTCAAGATAATGGTCATGGAATTAAAGTCTTAGACTTTCCA
TTACTCTGTGAAAGATTTGCTACTTCGAAGATTGAGAAATTTAGTGATCTGAAAAAGGTT
GGCAGCTTTGGTTTTAGAGGTGAAGCTTTAGCTTCAATATCTTATGTATCAAAGTTAACT
GTGACAAGTAAAGTACAAGATTCTGAACTTGCTTACTAAGCTGATTTTGTGAATGGAATA
ATGCTAAATGAAGATGGAAATGGTCCTAAACCTTGTGCAGGTTAATAAGGTACTACAATT
GTAGTCAAAGACTTATTCGCCAATAATCCTCAAAGAAAGAAATCAATGGGTGTGAATGAG
GAGTACTCAAAAATTGTAGATGTTGTCACAAAATACTCAGTTCATTATCCGATGATCAAA
TTTAGTTGCAGAAAGATGGATGACAAAAAGACAGATCTGTCAACTCATAACATTTAGAGG
CATCCTATCAACGACTTAGAACCGGCGGATTAGGAAAAGTAAAAGAATGTTCTAAGAATT
GACATCATTAAGAAAACATTTGGACAAAACTAAGCTGGAAAAGATTTTATTGAAGTTGTT
GACTAATTAGACTTATTTTAATACTCTATTTCAACCATAATGAACAGATTAGTTGAGTCA
GACAAGATCAAGAGGACACTTGATCAAGTTTACCAACAATTCTAACCCAAAGGTGGCTAT
TCATACTTCGTCTACATGTCTCTGTTTATTCCATCGGAGTAGATAGATGTTAATGTCCAT
CCTACTAAGAAACAAGTAATTTTTGAGAGATAGGAAGAGTTTGTTGAGTATATTCAAGAT
CTATTGATTGAAAAGATTGCTGGAACTACTGGAGAGAAGAGTTTTTAAATAGATGCTCCT
TCATAAAGAAACAGAAACAATTCAAGAAGTAACAATTATAGAGAGGAAATGCAATAGACT
GAGCAACTTCCTTATGTACATACTAGAGAACCAAGTGAACACCATAAGAAAAACTTGAAT
GCTATGCGCATGGTCAGAACAGATGCAACAGCTATGACACTGGATAGATTTTTAGTTTAG
GGAAGTTTGTCAAACAACACTAGAAATTCTGGCTAGGACAAATCAACTGTGGTTTCTATG
AATATAGTTGCAGTTAGAAAACTTATTCATGAATTCGAATAGGATATTGAACCAGATCTA
TAAGATAAATTCAAAAAACATACTTTTGTTGGATTCTTAACTCCTGAGCAGGTACTATTA
TAATTTGGTGTGAATTTGATGCTTGTATAAGTAGAGCCTCTTTTGAGAGAATTCCTATAT
TAAGAATCTTTAAGATAAGTTTAATCAATGGATAAGTATAGACTGTTTACCCCACTATCT
TTAAGTGAGTTACTCAAACTAGCTCTTGACTTGCCTTCAACCTAATATAATCCTAATATT
CATTTACCAAAGACGATAAAACCATATCCAGAGCTTTTGCCAAGCTTTATTTTGAGATTA
GCAACTGATGTAGATTATTCTTCTCAAAATAACTACTATCACTAAATCGCTGTTGAGCTT
TCTTATTACTACTCTAGTCTTGTGACTCAATTCAAGAATCATAATGTTTCTTATGATGAT
AATGGAAGCTATGGCTTGGGAGGTCTGGGACCAGGTTAAAATGGATAAATGTAACAAATA
AATGGCGTTAAAGATTTGAAAAAGGTAAGAGAGGAAGAACTTAGATGGCAATACCAATAT
AAATTATTCCCATAAATGAGAGGCAATTTGGTAATAAGAAGCAAATTTGGTGAACAAAAT
AATGCCACATTCACTTATTTAACTAAAGTTGAGAATTTATATAAGGTATTTGAAAGATGT
TGA


>Contig14864.0.g42(protein)
MNQDMKDESQVPSIRKLDEATINKIAAGEVVVSPSAALKEMIENSIDAGASRIDVLCQKS
GFDFMQIQDNGHGIKVLDFPLLCERFATSKIEKFSDLKKVGSFGFRGEALASISYVSKLT
VTSKVQDSELAYQADFVNGIMLNEDGNGPKPCAGQQGTTIVVKDLFANNPQRKKSMGVNE
EYSKIVDVVTKYSVHYPMIKFSCRKMDDKKTDLSTHNIQRHPINDLEPADQEKQKNVLRI
DIIKKTFGQNQAGKDFIEVVDQLDLFQYSISTIMNRLVESDKIKRTLDQVYQQFQPKGGY
SYFVYMSLFIPSEQIDVNVHPTKKQVIFERQEEFVEYIQDLLIEKIAGTTGEKSFQIDAP
SQRNRNNSRSNNYREEMQQTEQLPYVHTREPSEHHKKNLNAMRMVRTDATAMTLDRFLVQ
GSLSNNTRNSGQDKSTVVSMNIVAVRKLIHEFEQDIEPDLQDKFKKHTFVGFLTPEQVLL
QFGVNLMLVQVEPLLREFLYQESLRQVQSMDKYRLFTPLSLSELLKLALDLPSTQYNPNI
HLPKTIKPYPELLPSFILRLATDVDYSSQNNYYHQIAVELSYYYSSLVTQFKNHNVSYDD
NGSYGLGGLGPGQNGQMQQINGVKDLKKVREEELRWQYQYKLFPQMRGNLVIRSKFGEQN
NATFTYLTKVENLYKVFERC