Identifiers and Description

Gene Model Identifier

Contig14777.0.g76

Standard Name

None

Aliases

Contig14777_0_g76

Description

Glycosyl hydrolase family 20, catalytic domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00728 ) Glycosyl hydrolase family 20, catalytic domain
  • ( pfam02838 ) Glycosyl hydrolase family 20, domain 2

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001298203.0014466598835893e-101Glycosyl hydrolase family 20,
catalytic domai...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14777.0.g76(coding)
ATGAAGAGATTACAAAGTGTGATCCTTTTAGCTGCAGGTTTTGTAGCTCTTAGTACTTAA
TATTAGGATGACTTAGTCAGTAATGCCAAATTACAACCTACAATAATGCCTCCTCCAAAG
CAAATAACTCACGGGACTGGTCAAGCATTCATAGATCCCTGCTAATTCAACTTAAAGCAA
GAGAAACAATTCTTGAAAGGCAGTGAGCACATTGAAAACTTGTACTCTTACTATACAAAG
AGGTTGTTCCCTAAATTCTCTTTTGAAAGTTGCAGCAGCTATGACACATTAAAGACTGTA
GATTTGAAGCTTTTGAAGCATTTGAACTTGAAACTTAACTCTGGTGAGATAACCGAGTTG
CTATCACCTCATTTGCACGAAACAGACGAATCTTACGATTTGAAGATCCTCATGGATACA
GATGAGATCCAGATCACTGCCAATCAATATGTTGGTCTTGTGAGAGGTATGGCTACTGTC
AGTCAGTTGATATAGAAGTCCCACACTAAAGAGGGTGTGTTTGAAGTCAATCACTTGCCA
TTAGATATTTAAGATGCTCCTAGGTATGCCTACAGAGGGTTCATGCTTGATACATCCAGA
CACTATATCTCAGTAGATATTATCAAGCAGCTTTTAGATTCCCTTGCTCTTGCCAAGTTT
AGTGTTTTCCATTGGCACATCGTTGATGATGAAAGTTTCCCAATTGAGCTTGACTCATTC
CCAAATATTTCCAAAAATGGTGCCTTCTCAGCTGATAAGGTATATACCAAGACAAATGTT
CAAGGCATTGTGTCATATGCCTTAACTTTAGGTCTAAGAGTTATTCCCGAATTTGATAAC
CCAGGCCATACCAGAGCTATCGCTATGGATCCTGAGTTCCGTGACATCATGAGGTGTTGG
TCAAAGGATTGGTCATCTACTGTCCCAGGAGCTTATAGAATCTAGGGCATGAGAACAGGA
GTCCTTGATCCAACTTACGACTAAACTTTTGATTTGATTAAGGGTATATTCACTGACTTG
AATAGTTTATTCCCAGACAACATGCTGATGTTAGGTGGAGATGAAGTCTTAACTTCATGC
TACAACGAGAATCCAAAACTTTAGGACTTTATGACTAAAAACAACATTAAGGATTTACAA
GGAGTCTTCCAATACCACTTGGAGAAATCAAGAGGTATCTTGAAGACAGTAAACTCAAAT
AAGGTTGCACTTTATTGGTCAAATGAGGACACTCTCTACTTAAAGCATAACCCTGATGAT
GTGCTACTATGGTGGGGTCAATCAAAGAACCTTGATCAATTGAAAGCAACATACCCTCAA
AACAAGTTTGTTATGGTTGTTGGTGATGCTTACTATCTTGACTGTGGTAGAGGTAATAAG
TATGGTGCAAACTCATGGTGTGACCCATTCAAGACTTGGTGGTACATTTATCAATTCGAA
CCAACAGATTACTTGAATGATGGTTCTGTAATTGGTGGTCAAGTGGCTTCATGGTCTGAG
TAAATCAGTGATTACAATCTCCTTGCAACTATCTGGCCAAGAGCAGCAGCAATGGTTGAT
AAGATGTGGGGACCAAAGGTTCCACTTGACTTACAATCATTGGCAGCAAGACTTATCGCC
TTCAATTAATAACTCAACAATTTTGGCATTCCATCAAGTCCAATTACTGACGGCTATTGT
GAACAGAATAATGCTCAATGCTTTATCAAGAAGTAAACCTAAGAGCCATTTGAGAAGATT
GATTCTCAAATTAACAGATTCTACAGTCACGAATGA


>Contig14777.0.g76(protein)
MKRLQSVILLAAGFVALSTQYQDDLVSNAKLQPTIMPPPKQITHGTGQAFIDPCQFNLKQ
EKQFLKGSEHIENLYSYYTKRLFPKFSFESCSSYDTLKTVDLKLLKHLNLKLNSGEITEL
LSPHLHETDESYDLKILMDTDEIQITANQYVGLVRGMATVSQLIQKSHTKEGVFEVNHLP
LDIQDAPRYAYRGFMLDTSRHYISVDIIKQLLDSLALAKFSVFHWHIVDDESFPIELDSF
PNISKNGAFSADKVYTKTNVQGIVSYALTLGLRVIPEFDNPGHTRAIAMDPEFRDIMRCW
SKDWSSTVPGAYRIQGMRTGVLDPTYDQTFDLIKGIFTDLNSLFPDNMLMLGGDEVLTSC
YNENPKLQDFMTKNNIKDLQGVFQYHLEKSRGILKTVNSNKVALYWSNEDTLYLKHNPDD
VLLWWGQSKNLDQLKATYPQNKFVMVVGDAYYLDCGRGNKYGANSWCDPFKTWWYIYQFE
PTDYLNDGSVIGGQVASWSEQISDYNLLATIWPRAAAMVDKMWGPKVPLDLQSLAARLIA
FNQQLNNFGIPSSPITDGYCEQNNAQCFIKKQTQEPFEKIDSQINRFYSHE