Identifiers and Description

Gene Model Identifier

Contig14635.0.g92

Standard Name

None

Aliases

Contig14635_0_g92

Description

Sodium/hydrogen exchanger family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00999 ) Sodium/hydrogen exchanger family

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006212807.001811683013561e-96Ulp1 protease family, C-termin
al catalytic do...
SGDYDR456W1.000159011384939e-43NHX1 SGDID:S000002864, Chr IV
from 1367485-1369386, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14635.0.g92(coding)
ATGTCAGCACATTTATTCAGTTAGGGAGCCATCATTATTATGATGATCCTCCTCTTCTAC
ATGTTCGTGGGATCAGTTTTAGAGAAATATCATTGCAAGGTTGGACATGAGGCAGGCCTT
GTCATTATATTTGGAATGTTTCTTTCGTTCTTAGCATTCAACACAGGACACACCGATTTG
AATAAGATGGTCACATTCGAGGAGAATATCTTCTTCTACTTCTGCCTACCACCTATCGTC
TTTGCTTCCGGTTATAACATGAAGAGAAAGAAGTTCTTTGAGAATTTCAAGAACATTCTA
ATGTTTGGACTTTTCGGAACACTAATCACTTTCACAGCATTCTCAGTAATGACATACATC
GTGGTCTAGTTTGACATTCTTTGGAAATATAATGGACACACCGGTGAGTATGAGCAATTT
ACATTGTCTGTAATGGAGATCTTATTAATGTGTTCACTTTTATGCTGTACAGATGTCGTG
GCCGCTATTTCAATCATAAAATACGAGGAGTAGCCCAAGCTATTCTCCCTGGTATTCGGT
GAGGGTATCACCAATGATGCCGTGTGTATCATCCTTTTCAACACAGTTATGGAGTACTCA
GGACCTAATAGCGAGTTCACAGCTTCTACTCCCTTCAAAATTGTGGGAAGCTTTATCAGT
TTGAGCTTTTTCTCGATTATGGTGGGTATAGCTACTGGTATAGTTAGCTCTATAGTCACT
AAGAACTTCAGATTCCTTACCGTTAAACCAGTAGTGGAATGCACATTGATCTTCTGTTTC
GGTTACTTATCATATTGCATTGCAGAGCTTTTCCACTTCTCTGGAATTATATCTCTCTTG
GTGTGCTCAATTTTGATGGCGAAGTACTCCTGGTACAATCTCTCACCCCAATCAAAGCAA
GTCACCTCTATTGCTTTCAATGTGATCGGTTATGCAGTTGAGGCTTTCGTGTTCGGATAT
TTGGGACTAACTTTCTTCTCCTACGTTTCTTATGAATGGTCCTGGTAACTCTTTATCGCA
GAACTTATTATCGTTATTTTGGGAAGATTTATGGGAACTATTGGAATCATTAAGTTCCTG
GAATTATTTGGATACAAGTCAGGCATTAGATTCAAGGATCTTATTTTCATTTCATATGCT
GGCATGATTAGAGGAGCCGTTGCCTTCGGTCTAGTACTGAGAGTAGATGATAATATCGCA
AACAGATCAGTTATTGTGACAACATCTCTTGCATTAGTCGTAGTGACTACTGTTTTTATG
GGATCAACAGTAGCTTCAGTTCAACATTGTCTATTCGGCAAAGAAATGGCTGCAAAAGCT
AAGGCAGAGGCTACCCATCACTCCGTTAACCTTAATGAGAGTCACCACGAAGTGGTTGAG
CATCCAAACGTCGAAGATGTAGCTGGAGAGAACCAACGCTTAAATGGTGGAGGACAACAA
GAGAAAAGAGAAAAGAAACAAGGTTGCAGTTAAATAATGCGCAGATTAGATATGATGATT
ATCAAGCCACTCTTGATCTACAAGTACGAGCAAGGCACACACAAGAAGTAGAAACTCTTC
AATGACTTACTCATGCTTGAAGGGGAAAAACTTGAAGAGATCTTTGCCAACAGAGGAGAT
AATAATGACAGGAAATCTCACTCTCAAATATTGGATTTCTTAAATCAAAAGAGTGGACCA
AACATCAAATCAAATAGGTAGAGCATCCACGACCCTGAAAAATCAGAGAGACTCGACAGC
GAGAAATCTGGAGCAATTGAATTACAGACTCAAACAGCTCAACCCCAACTCACTGTAAAT
TAAAACTTTGGCAAACGTCTCGATTCATAACCATATGGTAGCATCTATTCAGATACCGAT
GGTCTCGGTGGAGTTAAATTACCACTAATTGACAACAACAAGAATCCATACGGAAACTGA


>Contig14635.0.g92(protein)
MSAHLFSQGAIIIMMILLFYMFVGSVLEKYHCKVGHEAGLVIIFGMFLSFLAFNTGHTDL
NKMVTFEENIFFYFCLPPIVFASGYNMKRKKFFENFKNILMFGLFGTLITFTAFSVMTYI
VVQFDILWKYNGHTGEYEQFTLSVMEILLMCSLLCCTDVVAAISIIKYEEQPKLFSLVFG
EGITNDAVCIILFNTVMEYSGPNSEFTASTPFKIVGSFISLSFFSIMVGIATGIVSSIVT
KNFRFLTVKPVVECTLIFCFGYLSYCIAELFHFSGIISLLVCSILMAKYSWYNLSPQSKQ
VTSIAFNVIGYAVEAFVFGYLGLTFFSYVSYEWSWQLFIAELIIVILGRFMGTIGIIKFL
ELFGYKSGIRFKDLIFISYAGMIRGAVAFGLVLRVDDNIANRSVIVTTSLALVVVTTVFM
GSTVASVQHCLFGKEMAAKAKAEATHHSVNLNESHHEVVEHPNVEDVAGENQRLNGGGQQ
EKREKKQGCSQIMRRLDMMIIKPLLIYKYEQGTHKKQKLFNDLLMLEGEKLEEIFANRGD
NNDRKSHSQILDFLNQKSGPNIKSNRQSIHDPEKSERLDSEKSGAIELQTQTAQPQLTVN
QNFGKRLDSQPYGSIYSDTDGLGGVKLPLIDNNKNPYGN