Identifiers and Description

Gene Model Identifier

Contig14613.0.g86

Standard Name

None

Aliases

Contig14613_0_g86

Description

Mitochondrial carrier protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002211004.0006908853687255e-76Mitochondrial carrier protein
SGDYLR348C7.003455847728069e-40DIC1 SGDID:S000004340, Chr XII
from 827873-826977, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14613.0.g86(coding)
ATGAGCTCATCTACTCAAAAAAACCAAAGAAAAGGCATGAACCCCCTTTTAGCTAACATG
ATAGCTGGAGCACTCGGTGCTTGCATCGCAGAGGCAGTGACAATCCCCATTGATCAAGCC
AAGGTGAGATTGCAATTATAAAATACTCCAGTTGGAGGGACTCCTAAGTATACAGGCATG
TTTTAAACTATTGGAAGAATAGTCTCAGAAGAGTCAGTAGTCAACCTATATAGAGGACTT
ACACCTGGTTTGTAAAGACAGTTCATGAATTGCTCAGTCAGATTTGGTCTCTATGAACAT
GTAAGGAATGCACTTTGTCCCAACCTTAAACCTGGTGAATTGCCACCTTTGAGCATGAAG
ATTGTTGCTGCAGCTATCACTGGATCAATCTCTATCTTCTTCGCTAACCCTATGGACGTT
GTCAAGGTCAGAATGCAATCATTAGCTAAAGAATTGGGTACTCAAGGCAAAATGCCATCA
TCTATTACAGTTTACTAGACAATTTATAAAAACGAGACATTCTGGGGATTCTATAGAGGC
ATCTAACCCAACATCGTTCGTAATGTATGCGTGAACATTGGAGAAATGGCTTCATATGAT
CAATTCAAGCAAATGTTGCTTCAATACACAGCAATGAAGGAAGGTATCACCTTGCATTTC
ACTGCTGGTTTCATGGCTGGTTTCGTAGCTACCTGTATCGCTAGTCCAGCTGATGTCGTT
AAGACCAGACTCATGAGTAGCCCAGATTCCTACACTGGTGTCGTGAACGCATTTACCAGA
ATGCTCAAGGAAGAGGGTCCAAAGTCCTTCTATAAGGGATTCATCCCCAATTTCATGAGA
CTAAGTATCTGGTCATGCACTTGCTTCATCGCAATGGAAAAAATCAAGGTATAACTAGCA
GGTCCTCCCAACAAGAAAGAATGA


>Contig14613.0.g86(protein)
MSSSTQKNQRKGMNPLLANMIAGALGACIAEAVTIPIDQAKVRLQLQNTPVGGTPKYTGM
FQTIGRIVSEESVVNLYRGLTPGLQRQFMNCSVRFGLYEHVRNALCPNLKPGELPPLSMK
IVAAAITGSISIFFANPMDVVKVRMQSLAKELGTQGKMPSSITVYQTIYKNETFWGFYRG
IQPNIVRNVCVNIGEMASYDQFKQMLLQYTAMKEGITLHFTAGFMAGFVATCIASPADVV
KTRLMSSPDSYTGVVNAFTRMLKEEGPKSFYKGFIPNFMRLSIWSCTCFIAMEKIKVQLA
GPPNKKE