Identifiers and Description

Gene Model Identifier

Contig14526.0.g10

Standard Name

None

Aliases

Contig14526_0_g10

Description

Glutathione peroxidase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008956502.0008536325002377e-42Glutathione peroxidase family
protein
SGDYBR244W2.0003218023735366e-33GPX2 SGDID:S000000448, Chr II
from 707528-708016, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14526.0.g10(coding)
ATGGAACACTCAGGCAACTACTCATCAGTTTGGGACATCCCAGTAACAGATATCAATGGC
ACTCACTACGCCAGACTCGGAGATAAGTTTGGTGAAAATAAACCCAAATTATCATTATTC
GTTAATGTGGCATCAAAGTGTGGACTTACAGACAGTCATTACAGTCAGTTGACTACTCTC
AGTGGGAAGTACAGAGAGCAAGGCTTTGAAGTACTTGCTTTTCCATGCAACCAATTCGGA
TCACAAGAGCCAGACTCCAATGCATCAATCCTTGATTTTGTCTGTTCTCGCTACTCTTCA
TCTGCATTCCATCTCTTCGACAAGATCGATGTAAATGGTGACAACGGCCATGAACTTTAC
AAATACTTGAAAAACTAATCAAGAATTGCTAAAATTACTTGGAATTTCGGGAAATTCTTG
GTTAATAAAGAGGGTTAGGTTCTTGAGTACGCGGATCCTCAAACCACTCCTAATGATCTC
ATCCCTAAGATTGAGCAGTATCTCAACACTCCATGA


>Contig14526.0.g10(protein)
MEHSGNYSSVWDIPVTDINGTHYARLGDKFGENKPKLSLFVNVASKCGLTDSHYSQLTTL
SGKYREQGFEVLAFPCNQFGSQEPDSNASILDFVCSRYSSSAFHLFDKIDVNGDNGHELY
KYLKNQSRIAKITWNFGKFLVNKEGQVLEYADPQTTPNDLIPKIEQYLNTP