Identifiers and Description

Gene Model Identifier

Contig14403.0.g67

Standard Name

ACT6 (Paramecium tetraurelia Actin 6 homologue)

Aliases

Contig14403_0_g67

Description

Actin

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYFL039C3.9988176960464313e-94ACT1 SGDID:S000001855, Chr VI
from 54377-53260,54696-54...
T. thermophilaTTHERM_001909503.9981372112117256e-92actin, identical

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14403.0.g67(coding)
ATGACAGCTATTCAGGAGAGATTAAAAAAGATGGAAACTTTCTTTGACTAGAAAGAATTC
GTCGTCATAGATCATGGTACTGGTTTTATCAAGGCTGGATTTTCAGGAGAAGACCTACCA
AGATGTGTTATCCCAACGGTTGTAGGCACTCACTAAATATAAATTGATCCTTCTCAGTAA
CCAGGATTATCTGGTGGCGGTTTACCTTAAGATGGCTCCTCACACAAAATTGAATATGCA
TTTGGAAATGCAGCCTTCGCTTAAAGATCTACTCACCAGTTGCATCAACCAATTAGAAGA
GGAGTCATTGAAGATTTTTAACATATGGAAAATCTTTGGGAATACATTTTCGAGCATGAG
CTTAACTTAGATCCTAAGAATATTAACGTTTTGCTGACTGATTCAGCCTTAAACACTAAA
GAAAATAAGCAAGAGATCGCTCAAATCATGTTTGAAACTTTCAAGGTAGAGTCATTAGCA
ATTATGAACACAGCTGTACTATCTTTGTTCTCAACAGGTAAGACTACTGGTATAGTTGCT
GAATGCGGAGAAGGAGTCAGTTACACTGTCCCAGTATTTGAGGGATATGCTCTGCCACAT
GCAATTCACAGTCTTGATCTTGCAGGAGAGGATGTTACAAATACTTTAATAGATTAAATG
GCTGCTGATAGAATCCCAGTAAATCAAAGCCACTTTGAGTATGTTAGAGAGATGAAGGAG
CAGATGTGTTCAGTTGCTCTTAACTATGAATCAGCAATTCACTCCCGTGATCCTCTTACT
GAAGAGCAAAGATCCTATGAACTTCCAGACGATAAGGGCATTATTCAAGTCGATCATAGA
AAGCGTTTCTTAGCAACTGAAGCTATTTTCAATCCTAAAATTATTGGAAGAGATGAAGCA
GGTATTGCAATGATTGCTTATAAAGCAATCGAAAAGTGTGACGCTGACTTAAAGATTAAC
CTATATAATAACGTAGTACTAGCAGGTGGTAGCACTTTAATGCCAGGCTTCCATGAGAGA
TTTGACTATGAATTGAAAGGACTCGCTATGAACTCTACTAAGACCGACATTAATGTTTAT
GCTGATCTTCATAGGAAATATGCTTCTTGGATTGGAGGATCAATGATTGCTAGCTTTAGT
ACATTTAATGATATGACAATAAAGAGAGATGAGTATGAAAACATTCAAGATGGAGAAAGA
TCTCATCTAATTCTTAAGAAAACCATATACTGA


>Contig14403.0.g67(protein)
MTAIQERLKKMETFFDQKEFVVIDHGTGFIKAGFSGEDLPRCVIPTVVGTHQIQIDPSQQ
PGLSGGGLPQDGSSHKIEYAFGNAAFAQRSTHQLHQPIRRGVIEDFQHMENLWEYIFEHE
LNLDPKNINVLLTDSALNTKENKQEIAQIMFETFKVESLAIMNTAVLSLFSTGKTTGIVA
ECGEGVSYTVPVFEGYALPHAIHSLDLAGEDVTNTLIDQMAADRIPVNQSHFEYVREMKE
QMCSVALNYESAIHSRDPLTEEQRSYELPDDKGIIQVDHRKRFLATEAIFNPKIIGRDEA
GIAMIAYKAIEKCDADLKINLYNNVVLAGGSTLMPGFHERFDYELKGLAMNSTKTDINVY
ADLHRKYASWIGGSMIASFSTFNDMTIKRDEYENIQDGERSHLILKKTIY