Identifiers and Description

Gene Model Identifier

Contig14352.0.g52

Standard Name

None

Aliases

Contig14352_0_g52

Description

SPFH domain / Band 7 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Biological Process

Domains

  • ( pfam01145 ) SPFH domain / Band 7 family
  • ( pfam11101 ) Protein of unknown function (DUF2884)
  • ( pfam12140 ) Protein of unknown function (DUF3588)
  • ( pfam03592 ) Terminase small subunit

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYGR231C6.002457252238691e-96PHB2 SGDID:S000003463, Chr VII
from 953480-952548, Geno...
T. thermophilaTTHERM_003886401.9998099689916736e-77SPFH domain / Band 7 family pr
otein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14352.0.g52(coding)
ATGAACTACAAGAAGCAACTGTCTCTCGCAGCCAGCACTATCTCTCCCTTCCTAATGCTC
TATTTAGGGTATAAATATACTATCTTCCATGTTGATACTGGTCATGGTGCAATTGTTTTC
AATAAATTCTCAGGAGTTAAGAATGAATTTTACAAGGAAGGATGGCACTTGATGCTCCCA
TGGTTCGAAAGACCCATTGTATACGATCTCCAGTCAAGACCCCTCACTCTTAAGTCAGTC
ACTGGATCTCAAGATTTGCAGATGGTTAATATTAGTTTGAGAATCTTGTATCGTCCAGAT
AAGACAAGACTCCCAGAACTTTACAGATTCTTGGGCCCAGACTACGACCAAAGAGTCCTC
CCCTCAATCGCCAACGAAGTCTTGAAGGCAGTCGTCGCTCAATACAACGCTTCAAAGTTG
TTGACTCAAAGAGAAGATGTTAGTAATTATATTAGAGCCACTCTCTAAGAAAGAGCAAAG
GATTTCATGATCTAAGTTGATGATATCTCTATTGTTGAGTTGTCCTTCTCACAGGAATAT
ACCAGAGCTGTTGAAGAGAAGCAAATTGCATAACAACAAGCTCAAAGAGCTCAATATATG
GTGCTACAGGCTCTTCAAGATAAGAAAAGTACTATTATTAGAGCTCAAGGAGAGGCCAGA
GCTGCCGAATTACTCGGACCTGCTATTGGTAAATCAGGAGCATATATTCAGATTAAGAGA
ATCGAAGCTGCCAGAGATATTGCAGATGCCCTCGCAAAGAGCAGAAACAGAGCTTTCCTC
GATTCAGATTCACTATTGCTTAACCTTACCGGTTCCTTTGATTCCAACTTGGAGAAGCTC
CCACTAGGCACCCCAGGCCACTACAGAGGAGATGGAGAAGTCATTGAAGCAAAAAAGGCA
TGA


>Contig14352.0.g52(protein)
MNYKKQLSLAASTISPFLMLYLGYKYTIFHVDTGHGAIVFNKFSGVKNEFYKEGWHLMLP
WFERPIVYDLQSRPLTLKSVTGSQDLQMVNISLRILYRPDKTRLPELYRFLGPDYDQRVL
PSIANEVLKAVVAQYNASKLLTQREDVSNYIRATLQERAKDFMIQVDDISIVELSFSQEY
TRAVEEKQIAQQQAQRAQYMVLQALQDKKSTIIRAQGEARAAELLGPAIGKSGAYIQIKR
IEAARDIADALAKSRNRAFLDSDSLLLNLTGSFDSNLEKLPLGTPGHYRGDGEVIEAKKA