Identifiers and Description

Gene Model Identifier

Contig14330.0.g57

Standard Name

None

Aliases

Contig14330_0_g57

Description

Phosphofructokinase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001703201.9999142828831432e-154Phosphofructokinase family pro
tein
SGDYGR240C1.9999391735788327e-19PFK1 SGDID:S000003472, Chr VII
from 973734-970771, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14330.0.g57(coding)
ATGAGTTTGAGTAAACCAGAGATGCTTGCATTCACTGGCATCAGTGCAGTAGCTGGTATG
ATCCTTGCTTCCCTCCTCTCCAATAATGATTGTGATGAAAACGATAGTTCAGTAAGACAT
ACAGAACCTAAATAAATCGCTCTAGCAGAGGTGCAAGTCGATCAAACCGACGAGACTTTT
GAGCTAAAGAAACTCATCAGAAAGCAACAAGAAATGACTCAGCAGTTGATGCAGTTAGCA
GCTCCTATAGTGGATAGATGCCCTCATTTAGTTGATTTATATGGTTTAGCTGAGAGGTTT
ATGGCCAGTCCACTTATTGGAGACAATCTGAAGCGTTCAATTTTTGGCGGTGGTGGATTT
TTACCTAAAGACTCATTTATGGCTGATGATGCATTTGTGATTGCTACAAAAGATCATGCA
ACAATGAAAGAAGTTGTTTAGTCACTTAAATTCACTAAAGGTGGGCCAAGGGAACATGTG
TTTTTCAATCCTAAGAAAGTCAAGGCAGCTATTGTCACATGTGGAGGCCTTTGTCCAGGA
TTGAACGTAGTAATAAGAGAAATTGTGATGTCTTTGCATTTCAACTATGAAGCCCCTGAG
GTTTATGGAATTCAATGGGGTTATAAGGGTTTCTACTCTAACCCAGAAAAAACATGGATG
AAGCTGACTCCTTCCGTAGTAAAAAACATTCATAAAATTGGTGGCACCATACTTGGATCA
TCAAGAGGAGGATTTGACAAGGATAAGATTTTGAACTCTTTGTAAGAAAGAGGCGTAAAT
CAAGTGTACATAATAGGTGGAGATGGCACTCACCGCGGAATTAACGAATTAATAAAACGT
GCAATGGAAAGAAAAATGGTTATATCCTTCGTTGGTATCCCAAAGACAATCGATAACGAT
ATTCCCATAATTGATAACTCATTTGGATTTAACACTGCTTGCGAGGTTGCAGAGAGGATG
ATTGAAGCTGCTTATACTGAAGCTACTAATGCTCAGAATGGTGTGGGACTTGTCAAATTG
ATGGGTAGATACAGTGGATTTATTGCTAGAAATGCATCACTTGCAAGTGGTAATGTTGAT
ATTTGTTTGATACCTGAACTTCCATTTGAGCTCTACGGTCCAAAGGGTTTCTATGAACAG
GTAGTTGCCAAAATAAAAGAACAAAAATATTGCATTATAGTCGTAGCAGAGGGTGCAGAA
GAAGGCCTTATTAATCCCAATGAAAAAATTACTCAAAACGAGCGAAGAGACGACTCCAAC
AACCTAATTTACGACGATATAGGCAAATTCTTGAAAGACGCAATCCCCAAGTATGCGAAG
GACACTCACAGCATGGCTATTACACTGAAGTACATTGACCCTACTTATGCAATCAGAAGT
GTCGCTTCCAATGCAGTTGACACTATTATGTGTGCTAAACTTGCTCAAAATGCTGTACAT
GGGGCTATGTATGGATATACTGGATTTTCAGTTGGAGTTGTAAGAAACGCAGTTGCATAC
ATCCCAGTTACCACTTTAATCGAGGCTGGCACAAACAGAGTGAGCATGACTGAAAGGACA
TGGCAGCGTCTCATGGCTCAAAACAGGCAAAAATACATGATTAACGATGAATTTAAGGAT
AAAGCCTGGGAATGCATCAGAGGCAAATAAGACGAGAGAAAGCAAATTTTCAAGGGTATT
ATGAAGAGAGTGAGAGCCAAACATGATGCCATCATTAAAGGCACTAATCTGCATAATACT
GAACCAGAAATTGATAATGCTTGA


>Contig14330.0.g57(protein)
MSLSKPEMLAFTGISAVAGMILASLLSNNDCDENDSSVRHTEPKQIALAEVQVDQTDETF
ELKKLIRKQQEMTQQLMQLAAPIVDRCPHLVDLYGLAERFMASPLIGDNLKRSIFGGGGF
LPKDSFMADDAFVIATKDHATMKEVVQSLKFTKGGPREHVFFNPKKVKAAIVTCGGLCPG
LNVVIREIVMSLHFNYEAPEVYGIQWGYKGFYSNPEKTWMKLTPSVVKNIHKIGGTILGS
SRGGFDKDKILNSLQERGVNQVYIIGGDGTHRGINELIKRAMERKMVISFVGIPKTIDND
IPIIDNSFGFNTACEVAERMIEAAYTEATNAQNGVGLVKLMGRYSGFIARNASLASGNVD
ICLIPELPFELYGPKGFYEQVVAKIKEQKYCIIVVAEGAEEGLINPNEKITQNERRDDSN
NLIYDDIGKFLKDAIPKYAKDTHSMAITLKYIDPTYAIRSVASNAVDTIMCAKLAQNAVH
GAMYGYTGFSVGVVRNAVAYIPVTTLIEAGTNRVSMTERTWQRLMAQNRQKYMINDEFKD
KAWECIRGKQDERKQIFKGIMKRVRAKHDAIIKGTNLHNTEPEIDNA