Identifiers and Description

Gene Model Identifier

Contig14276.0.g39

Standard Name

None

Aliases

Contig14276_0_g39

Description

Ubiquitin-conjugating enzyme

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011239504.998816730869543e-67ubiquitin-conjugating enzyme
SGDYDR092W1.9990871925214856e-61UBC13 SGDID:S000002499, Chr IV
from 629876-629905,63017...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14276.0.g39(coding)
ATGTCCGGAATTCCACCTAGAATTTTGAAAGAAACCCAAAGACTCGCTTAAGAACCAGTT
GTTGGTATTTATGCTGAACCAAGCGAGAACAATCACAGGCATTTCTTTGTTAAAATCGCA
GGACCAGAGGGAACCTCTTACGAAGGCGGTATGTTCCATGCTGAACTCTACTTGCCAGAC
GAGTACCCAATGGTCCCACCCAAGGTTCTCTTCAGAACCAAGATCTTCCACCCAAATATT
GATAAGTTAGGCAGAATCTGTCTTGATATCTTAAAGGACAAGTGGAGTCCCGCTCTTCAA
ATCAGATCAGTATTGCTATCAATTTAAGCTCTGATGTCTGCCCCCAACCTTGACGATCCC
CTTGACCAAGAAATTGCTGATTTCTTTAAGTAAGACCCAGAGGGAGCAATTAAGAGAGCC
AGAGAATGGACTATCCAGTACGCCAACAATTGA


>Contig14276.0.g39(protein)
MSGIPPRILKETQRLAQEPVVGIYAEPSENNHRHFFVKIAGPEGTSYEGGMFHAELYLPD
EYPMVPPKVLFRTKIFHPNIDKLGRICLDILKDKWSPALQIRSVLLSIQALMSAPNLDDP
LDQEIADFFKQDPEGAIKRAREWTIQYANN