Identifiers and Description

Gene Model Identifier

Contig14213.0.g44

Standard Name

None

Aliases

Contig14213_0_g44

Description

Copper/zinc superoxide dismutase (SODC)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00080 ) Copper/zinc superoxide dismutase (SODC)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYJR104C9.998397555368434e-52SOD1 SGDID:S000003865, Chr X f
rom 623014-622550, Genome...
T. thermophilaTTHERM_003136204.999456391042964e-45Copper/zinc superoxide dismuta
se family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14213.0.g44(coding)
ATGGCCTCAAGATTCTTAATGCTCTCACTCGGAGCTTATGCTTACAATCGTCAATAAACC
TCAAATTAAGCTAACCAACACAGTGAGATGGAAGCAACTGAAGATGCTCCTCGTCAAGCC
ATTTGCATTCTAAATGCCGAGAAAGGACAAACAGCTCATGGCGTTGTTCACTTCTTATAA
AACTCAATGTTCTAAAAGACAAGAATTTAAGGCGAATTCCAGGGTCTCACACCCTCTCAC
AAACACGGCTTCCACATTCATCAATACGGCAACTTGAGTCAGGGATGCGTGACTGCTGGT
CCACACTTCAACCCACTTAACCAGCTTCATGGAGGGCCAGATTCCATTATCAGACATGTT
GGAGATTTAGGCAATATTCAAGCTGATGACCAAGGACTAAGCAAGCTTGACTTCGAAGAT
CACCAAATAACTCTACATGGCCCACTTTCAATTGTTGGAAGAGCATGCGTACTACACAGA
GACACGGACGACCATGGCACTGCTGACAACGAAGAGTCAAAGAAAACTGGAAACGCAGGG
CCAAGAATCGCATGTGGCATCATCGGCCTCTCTAAAGAGTGA


>Contig14213.0.g44(protein)
MASRFLMLSLGAYAYNRQQTSNQANQHSEMEATEDAPRQAICILNAEKGQTAHGVVHFLQ
NSMFQKTRIQGEFQGLTPSHKHGFHIHQYGNLSQGCVTAGPHFNPLNQLHGGPDSIIRHV
GDLGNIQADDQGLSKLDFEDHQITLHGPLSIVGRACVLHRDTDDHGTADNEESKKTGNAG
PRIACGIIGLSKE