Identifiers and Description

Gene Model Identifier

Contig14189.0.g44

Standard Name

None

Aliases

Contig14189_0_g44

Description

AIR synthase related protein, C-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam02769 ) AIR synthase related protein, C-terminal domain
  • ( pfam00586 ) AIR synthase related protein, N-terminal domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005225805.002220803647507e-75selenide, water dikinase famil
y protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14189.0.g44(coding)
ATGTCAAACTGCCTGCTAACTTTTCGGTGCAAAGTGCCCTCGGCTACACTTTTTAAGTAT
CTGAAGGACATCGGCGATGGTTCAATTGCCAAAGAAACTCCAGACTGCAGTGTAACCAAA
TACATTCACGATCCTACTAAGCATTTGATCTCAACAACTGACTTTTTCTATCCACTTGTT
GAAGATCCATACATGCAAGGTAGGATAGCTTGTTGCAACACACTTAGCGATATCTACGCA
ATGGGTATCGACAGAGTAGACCATATGTTGATGATTTTAGGTGTGTCGCTAACAATGCAA
GAAGAACACAGGGAAATTGTCACAAGGGAGATGATAAGAGGATTTAACGACTGCGCCGTA
GAGGCAAAGACTATGGTTACCGGTGGTTAGAGCATCATGAACCCATGGCCTATCATTGGA
GGTGTTGCCAATGTAGTCTGCCATGAAGATGAGTACATATTGCCCAGAAGAGGAAAAGAT
GGAGATGTGATAATATTAACTAAACCGCTTGGTACTTAAGTTTCTGTAAATGTTAACGAA
TGGAAAGTTAAAAATAATGAAAGATGGGAATAAAGCAAAAAGTACATAACAGATGAAGAA
GCAATAAAAGCTTATTATTTATCTATGGAATCGATGGCAACTCTAAACATTAATGCAGCA
AAACTAATGAAAAAGTACAATTCCCACGGAGCAACGGACATCACTGGCTTTGGAATATTA
GGACATGCTCAGAATCTAGCCACAGCCTAATATGATGATGTTGATATCACAATTCATTCA
CTGCCAATCATTAATAAAATGGAACTCATCAACAACAACATTCTCAATTTCAAGTTACTT
CAAGGTTACTCAGCTGAAACAAGCGGTGGATTGTTCTTGATGCTTGAAAAATCAAAAGTC
AAAGATTACATGAGAGAGTTGAAGGAAGTTTATGGACAGGAAAGTTGGGAAGTAGGTTAG
GTCACAAAAGGCTCTAAAAAAGCTAGTATAAGAGAAGATGTGCAAGTAATTAATGTCAAA
GAATCTTTCCTATAAGATTGA


>Contig14189.0.g44(protein)
MSNCLLTFRCKVPSATLFKYLKDIGDGSIAKETPDCSVTKYIHDPTKHLISTTDFFYPLV
EDPYMQGRIACCNTLSDIYAMGIDRVDHMLMILGVSLTMQEEHREIVTREMIRGFNDCAV
EAKTMVTGGQSIMNPWPIIGGVANVVCHEDEYILPRRGKDGDVIILTKPLGTQVSVNVNE
WKVKNNERWEQSKKYITDEEAIKAYYLSMESMATLNINAAKLMKKYNSHGATDITGFGIL
GHAQNLATAQYDDVDITIHSLPIINKMELINNNILNFKLLQGYSAETSGGLFLMLEKSKV
KDYMRELKEVYGQESWEVGQVTKGSKKASIREDVQVINVKESFLQD