Identifiers and Description

Gene Model Identifier

Contig14167.0.g67

Standard Name

None

Aliases

Contig14167_0_g67

Description

Cyclin, N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006244503.001416859614811e-48Cyclin, N-terminal domain cont
aining protein
SGDYGR109C6.998542127613979e-20CLB6 SGDID:S000003341, Chr VII
from 706501-705359, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14167.0.g67(coding)
ATGAAAAAAATAAACTACTTAGATAATTTAAGATCAAAGGCCCAAACAGCCACTTAGATA
AGAAAAATAGAGCAAAAGCGAGTTGAGACTTCAGTTTACCCAGATGAGTACGAAGATGAG
ATTATCTACACTGATTCATTAGCAGCTATGGACAATTAAATTACAGTTTAAACTGACATA
AGTTTCAACCAAGAAAATTTATCAACGACATGGGGAAAAGAAAACTTGACACAGCTTCTA
GACTATAAAATGAATGCCTGTGCTTAAAACTCTAACAATTTCAAAAGTAGCAGAGAGCAA
CCCTAAAAGCCTAATTCAATACAACAAAGCAATAATCACTAATCGCATCATTAAAGAACA
CTCTCTGCTAATATACCATATGCAAGTATGAATAGAAATAATATACCTAGAGAAAGTAAC
ATAAAGGAGCATGAGAAGCAAAATTACAGAGAAAATACATCAATAGGCTGTTTACAGACT
CAATACGCAAGCAATAACTCATCAAGCAGTTCGACAAAATAAAACTCTAATCCCTCAAGT
TCTGGCTGTGGTTAGAAGACCCAGTCTAAAGTGGCATTACAGAGCAATATTAATGTGATT
AATAAGCACTACGAAGAAATAATATAGTCAAATTAGAGATAAGTTCTTGTAAGCAAAGTT
GTTGATTAGAATGTGAAAAAGCCTGTTTAAAACAATAATTATCATTAAAGAGCTTAGTCA
TATCAAACTTATGATAATAAAAAGTTTGGCTTTATTCCAGATCACCAAAGCTTAACACAT
TAATTCACTACATACGATGAAACTGGACTTTAAAAGTGGCAAACAGAGATATCAGAAGAG
GACGATGACGAAGGGGAAAATTTAATAGATGGAGAAAACGAAGAGATATCACTTTAGTAT
TTCTATTAAGACTTAGATAAGCAGCCACTTATGACTAAATATTAATAAATAGATTCTCCT
TCTAATGAGATTTCCATCAAACCTATGACAATAACTAGAGAGGACAGGAACTAAAAGTTG
CTTGAATCAACTTCAGAGCAAATCAATATGCATACCTATGAAAACTATGAATAAAATGAC
GATCATTTATAGTTACAAACTTTTGAGAAGCTAAACAGCTTTATTTATGATGATATATCT
GACTATGGTCAAACAACAGTTATTAAAGATCATATTTAAATTACATAGCAACTAGATTCC
CTAGAGTTATCCCTTCACTGTGGAGAAGACAAAGACAATTTATTATCAACATAGCAGTTT
AATGAGATACTTGCTGGGAATAATTAAGACGAGGAAGAATTGCTAGCTTAAAGTGAATTT
ATTGAGGAGAGAGGCATTTACTAAGTTTAAGACAATATGCAAACTCTCACAGATTATTCT
TATCTTGGTTAATAGATAAGCCCCTAATAATAGTTTTAGATTTAGGTGCTGGAATAGATG
CTGCTAAGAGACTAAGAATATAGAATAAATTCATCGTTCTTATAGCGCTAGAAAAATATT
ACTCCAAAAATGAGAGAAATTCTCATAGATTGGATGATGGAAGTAGGTGAAGAATTTATG
CTTAAGAGAGAGACCTTAAATATCAGTGTAAATTACATAGATAGATATTTAAGTCAAGCA
ACCTACCTGATCCCTAAAAATGAACTGTAGCTTATAGGTGTAGCCTCTATGCTAATAGCT
TGCAAAATTGAAGAAGTTTATATTCCAAGAGTAAACGACTTTGCTCTATCAACTGATGGT
GGATATACAAAAGAGCAAATTCTAATGATGGAGGGATATCTAATGAAAGTTTTGGCATTT
AAACTTCATCCAATAACTTTATCTAATTGGATGAATTGGTATATGAATATGTGGGATATC
TACCAGGATCAAAGTTTGAAGCAATATTATCAAACTGCAGATTTTACTTTTAAACAGCCT
AACGAAGTAGCTTATTAAAGATTCCGAATAGCCTACCAGATTCTTGATACGATAATTTTG
AACCCTTATTATAACGATTTTGATTCAAGACAATTAGTAGCTTCAATCCTCTATCTTATA
ATAGGTGGTCCACATATGATTGGGGCTTTTAATTATGATTACTAATGGTTTCCTTCATAA
TTTTAGAGATTCCCTCCCTTTGATTTCAGTAGAGGTAAAAAGAGATATTACTAACCGGAT
GAGCACGTGAACTTCTACAATTAAATTTTTGAAGCATTTCTCACAGAGTGCTTTGGATTT
CAACTTGAAGATTTAATTGAATCTATATAGTTTGTTATAAATTACTTTGCTCTACCAATG
TCTTTTGATCTACCACCTGCAGCTTCTAATAATCAAGATACTATGGCAACTGTAAGATTT
TTAATATTTTAAATATGTGCTTTTATAGAAAAATTACGAGGAATTTTTATCATTCTAAAC
ACATAATAAATACATGGTGGACTTCTTGAAGTCTATTCAAGGATATTGAATGAAACTATT
AGAAAATGA


>Contig14167.0.g67(protein)
MKKINYLDNLRSKAQTATQIRKIEQKRVETSVYPDEYEDEIIYTDSLAAMDNQITVQTDI
SFNQENLSTTWGKENLTQLLDYKMNACAQNSNNFKSSREQPQKPNSIQQSNNHQSHHQRT
LSANIPYASMNRNNIPRESNIKEHEKQNYRENTSIGCLQTQYASNNSSSSSTKQNSNPSS
SGCGQKTQSKVALQSNINVINKHYEEIIQSNQRQVLVSKVVDQNVKKPVQNNNYHQRAQS
YQTYDNKKFGFIPDHQSLTHQFTTYDETGLQKWQTEISEEDDDEGENLIDGENEEISLQY
FYQDLDKQPLMTKYQQIDSPSNEISIKPMTITREDRNQKLLESTSEQINMHTYENYEQND
DHLQLQTFEKLNSFIYDDISDYGQTTVIKDHIQITQQLDSLELSLHCGEDKDNLLSTQQF
NEILAGNNQDEEELLAQSEFIEERGIYQVQDNMQTLTDYSYLGQQISPQQQFQIQVLEQM
LLRDQEYRINSSFLQRQKNITPKMREILIDWMMEVGEEFMLKRETLNISVNYIDRYLSQA
TYLIPKNELQLIGVASMLIACKIEEVYIPRVNDFALSTDGGYTKEQILMMEGYLMKVLAF
KLHPITLSNWMNWYMNMWDIYQDQSLKQYYQTADFTFKQPNEVAYQRFRIAYQILDTIIL
NPYYNDFDSRQLVASILYLIIGGPHMIGAFNYDYQWFPSQFQRFPPFDFSRGKKRYYQPD
EHVNFYNQIFEAFLTECFGFQLEDLIESIQFVINYFALPMSFDLPPAASNNQDTMATVRF
LIFQICAFIEKLRGIFIILNTQQIHGGLLEVYSRILNETIRK