Identifiers and Description

Gene Model Identifier

Contig14042.0.g94

Standard Name

ARP3 (Paramecium tetraurelia Actin-Related Protein 3 homologue)

Aliases

Contig14042_0_g94

Description

Actin

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004421001.000274544751666e-156Actin family protein
SGDYJR065C9.998919090800975e-129ARP3 SGDID:S000003826, Chr X f
rom 559158-557809, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14042.0.g94(coding)
ATGCAGCAGGCTACAGTAGTCATTGACAATGGAACTGGATATACCAAGATGGGATATGCA
GGAAATATGGAACCTAGTTATCTTATCCCAACTGCTCTCGCCGACTCTAGATAAAAAGGA
GCCTCCAAGGTCTCAAACTAGAATGATTTCAAAAATCCAGAGCTAGATTTTTATATTGGA
GATGAAGCATTCGCACATTAAAAGACTCATGATGTCATTAATATTATAAGAAGTGGACAA
ATCGAAAATTGGGAAGCAATGGAGAAATTCTGGCACAGAGCTATCTATTCTTACTTAAGA
TGTGAACCAGAAGAGCACAGATTCATTTTAACTGAGCCACCAATGAACACTCCCGAGAAC
AGAGAACAAATGGCAGAGATCATGTTTGAAACATTTAATGTAAAGGGGCTTTTTATTGGA
GTGCAGGCAACTCTTGCTCTTTATGCTCAGCTTTGCGGACCAGATTCACAAAACAAAACT
ATTGGCAAATCTGATCTTACAGGTACTGTGATAGATTCAGGTGATGGAGTTACCCATGTG
TTCCCAGTTAGTGATGGTTTTGTTATTGGAAGTTGTGTCAGACACATTCCATTAGCTGGT
AGAGACATTACTAAATTTACACTTTAACATCTAAGAGATAGAGGTGAGAAACTACCAGGA
GATGATGCCATGGACATTGCCTAGAAAGTTAAGGAAAAGTTTGGATATGTCTGCAAAGAT
GTAGTCAAGGAATATCAAAAGTATGATAAAAAGACAGTCGATGACCAGGGAAGAATCTTC
TAATCAAACAAATTTAAGAAATACAATCATAAATCAGCATTAACAGGAGAGACCACTGAG
ATTGATGTAGGCTATGAAAGATTTTTAGGACCAGAAATGTTTTTCCATCCAGAGTTCGTC
CATTAAGATTGGAGATCCCCTCTTGATGAAATAGTAGATAACGCTATTTAATCTTGTCCT
ATTGATACAAGAAGAAAGCTTTATGAAAATGTAGTGCTCTCTGGAGGTAGCACTTTGTTT
AAGGACTTTGATAAGAGACTTAACAAGCAAATTCAAGTGAGAATAGATGACAGATTCAAA
TAATACTAAGCACTAACTGGATAAGCTCCAAAGCCAATCAAAGCTAATGTGTTTTAAAAT
ATGGTGCAGAGATATGCAGTTTGGTTTGGAGGTAGTGTCTTGGGTAGTTCTGAGCATTTT
CCTAAGATTTGTCACAGCAGAGAAGACTATATGGAGAGAGGACCATCAATTTGCAGACAT
AATCCTGTATTCCCAGCTGGATATTGA


>Contig14042.0.g94(protein)
MQQATVVIDNGTGYTKMGYAGNMEPSYLIPTALADSRQKGASKVSNQNDFKNPELDFYIG
DEAFAHQKTHDVINIIRSGQIENWEAMEKFWHRAIYSYLRCEPEEHRFILTEPPMNTPEN
REQMAEIMFETFNVKGLFIGVQATLALYAQLCGPDSQNKTIGKSDLTGTVIDSGDGVTHV
FPVSDGFVIGSCVRHIPLAGRDITKFTLQHLRDRGEKLPGDDAMDIAQKVKEKFGYVCKD
VVKEYQKYDKKTVDDQGRIFQSNKFKKYNHKSALTGETTEIDVGYERFLGPEMFFHPEFV
HQDWRSPLDEIVDNAIQSCPIDTRRKLYENVVLSGGSTLFKDFDKRLNKQIQVRIDDRFK
QYQALTGQAPKPIKANVFQNMVQRYAVWFGGSVLGSSEHFPKICHSREDYMERGPSICRH
NPVFPAGY