Identifiers and Description

Gene Model Identifier

Contig13931.0.g32

Standard Name

None

Aliases

Contig13931_0_g32

Description

EF hand

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00036 ) EF hand
  • ( pfam13499 ) EF-hand domain pair
  • ( pfam13833 ) EF-hand domain pair
  • ( pfam13405 ) EF-hand domain
  • ( pfam13202 ) EF hand
  • ( pfam12763 ) Cytoskeletal-regulatory complex EF hand
  • ( pfam10591 ) Secreted protein acidic and rich in cysteine Ca binding region
  • ( pfam09373 ) Pseudomurein-binding repeat
  • ( pfam03448 ) MgtE intracellular N domain
  • ( pfam13720 ) Udp N-acetylglucosamine O-acyltransferase; Domain 2
  • ( pfam05872 ) Bacterial protein of unknown function (DUF853)
  • ( pfam11829 ) Protein of unknown function (DUF3349)
  • ( pfam01595 ) Domain of unknown function DUF21
  • ( pfam13623 ) SurA N-terminal domain
  • ( pfam13155 ) Toprim-like
  • ( pfam05042 ) Caleosin related protein
  • ( pfam03963 ) Flagellar hook capping protein - N-terminal region
  • ( pfam09851 ) Short C-terminal domain
  • ( pfam08236 ) SRI (Set2 Rpb1 interacting) domain
  • ( pfam14297 ) Domain of unknown function (DUF4373)
  • ( pfam05099 ) Tellurite resistance protein TerB
  • ( pfam03819 ) MazG nucleotide pyrophosphohydrolase domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003849109.999030951775615e-88EF hand family protein
SGDYOR257W5.00115835552873e-49CDC31 SGDID:S000005783, Chr XV
from 811008-811493, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13931.0.g32(coding)
ATGGCAACTTACAAGAAGACTCAAATCGCTAAGCCCAAGAGAAGAACTGAGCTCACTGAA
GAGCAGAAGCAAGAGATCAAGGAGGCCTTTGACTTGTTCGATACTGACGGTTCAGGCACC
ATCGACGCCAAGGAATTGAAGGTCGCCATGAGAGCCCTCGGTTTCGAGCCAAAGAAGGAG
GAAATCAGAAAGATGATTGCTGATGTAGACAAGGATGGCTCAGGCGTAATTGACTTCACT
GAATTCTTGGACATGATGACTGTCAAGATGGCCGAGAGAGACCCCAGAGAGGAGATGCTC
AAGGCTTTCAGGCTGTTCGACGACGATGAGTCAGGAAAGATTTCATTCAAGAACTTGAAG
AGAGTCGCCAAGGAACTCGGAGAGAACATGACTGACGAGGAGATCTAGGAGATGATTGAC
GAGGCTGACAGAGACGGTGATGGAGAGATCAGTGAAGAGGAATTCATGAGAATTATGAAA
AAGACCAACTTATTCTGA


>Contig13931.0.g32(protein)
MATYKKTQIAKPKRRTELTEEQKQEIKEAFDLFDTDGSGTIDAKELKVAMRALGFEPKKE
EIRKMIADVDKDGSGVIDFTEFLDMMTVKMAERDPREEMLKAFRLFDDDESGKISFKNLK
RVAKELGENMTDEEIQEMIDEADRDGDGEISEEEFMRIMKKTNLF