Identifiers and Description

Gene Model Identifier

Contig13881.0.g75

Standard Name

None

Aliases

Contig13881_0_g75

Description

Mitochondrial carrier protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005307302.9990539278805726e-74Mitochondrial carrier protein
SGDYMR166C4.9985000769285e-31YMR166C SGDID:S000004776, Chr
XIII from 594473-593367, ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13881.0.g75(coding)
ATGGAAAATTAACAATAAAACCTTCAAAATAATGAATAATCAGAAGCTAAACCTGAAATT
CATGCGTAATAATCCACTAAAACAACTTAATAAATTGATAATTAACAACAAAAGTAGCAG
AAAGTATAGTCAAGCTCAGCTTTGACCTCCACTATTTCAGGGTTAATTGCAAGTTCAGTA
GGGAAAACATTAGTGCACCCTGTAGATACAATTAAAGCTAAATTGTAAGTTCAATCTGCT
TAAAAAAAGTCAACATTGAATCAATAAGGAGCTGCTTAAAGCTAATAAATGACCTCGATT
CGTTCACTCATGCGAAACTCTTTAATTCTGTCGATAGCAAGAGACACCATAAAGCACGAT
GGGATTGGGGGATTATATAGAGGCTTCGCTATCAATATATTAGGGTCTATTCCTGCAGCA
GGTATTTATTTCGGAAGCTATGAGTTCTTCAAAAATAACACCTTGCAATATTCATATCTT
TAACAGCACCCCTTCATTTCTTACCTATTGGGTGGTATGTTCGCTGAAACTATGAGTTGT
ATATTGTTTGTGCCGATTGATGTTATCAAAGAGCGAAGACAAGTGCAAAGTGATCTCAAG
ACTTACAACTATAGGAATGACGTTGATGCGATAAGACAGGTAATGAAGACAGAAGGAGCA
AGGGGCTTGTATAGAGCTTATGGAGCCACGGTTATGTCTTTTGGACCATTTTCAGCTTTT
TACTTTCTGTTTTATGAAAAAATGAAGGGACTCTTTGTTGCTAATGATGTGTAAAGTTAC
TTAAAGAAAACTGGGCGCAAAGATGAAGAAAGTGTGAAAGCATCTCATAAATAAGATATA
GGATTCTTCTAATCTATGTTTTGCAGTATGATTGCTGGTGCAGGAGCAAGTGTAATTACA
AACCCTCTAGATATGGCTAAACTTAGATTATAAGTTCAAAGAGCAGGTAAGATAGGAGGA
GGAGAAAAAGGGGAATTTTACTATAAACATATGCTAGATGGAGTATACAAAATAGGTAGA
GATGAGGGGGTGAGAGCGCTGTTCAACGGTTCCTTCGCAAGAATATTGTTTCATGTGCCA
AATGTAGCAATTACTATGAGCTTGGTAGAGTGGGTCAAACCTCAAGTCTAGAAATATTTA
GACAGGAATATGATTGATTGA


>Contig13881.0.g75(protein)
MENQQQNLQNNEQSEAKPEIHAQQSTKTTQQIDNQQQKQQKVQSSSALTSTISGLIASSV
GKTLVHPVDTIKAKLQVQSAQKKSTLNQQGAAQSQQMTSIRSLMRNSLILSIARDTIKHD
GIGGLYRGFAINILGSIPAAGIYFGSYEFFKNNTLQYSYLQQHPFISYLLGGMFAETMSC
ILFVPIDVIKERRQVQSDLKTYNYRNDVDAIRQVMKTEGARGLYRAYGATVMSFGPFSAF
YFLFYEKMKGLFVANDVQSYLKKTGRKDEESVKASHKQDIGFFQSMFCSMIAGAGASVIT
NPLDMAKLRLQVQRAGKIGGGEKGEFYYKHMLDGVYKIGRDEGVRALFNGSFARILFHVP
NVAITMSLVEWVKPQVQKYLDRNMID