Identifiers and Description

Gene Model Identifier

Contig1379.1.g49

Standard Name

None

Aliases

Contig1379_1_g49

Description

Ras family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYFL038C9.999142814001536e-47YPT1 SGDID:S000001856, Chr VI
from 55986-55366, Genome ...
T. thermophilaTTHERM_002797505.002382393859839e-46Ras family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1379.1.g49(coding)
ATGGCTTAAAAGAAAATACAAATTATCATCTTAGGAGATGGTGCAGTCGGTAAAACCTCA
CTTCTCAGAATGTATTCTGAGAAGCAGTTTACGCAGAGTCACATGGCCACCATAGGTCTG
GATTACGTGTCAACCACCTTCAAATCCCCTAACACCGAGGACATCGCAGTGAAGATCTGG
GACACAGCAGGCCAAGAGCGTTTCAAGACAATTACTTACTCTTTCTACAAGCAAGCACAC
GGTGTCATAGTTACATTCGATGTGACAAACCAATAATCCTTCAACAATGTGAAAACATGG
CTGGAGTCAATTTACCAACACGCAGATCCCAGCATCACCAAGGTCCTTGTGGGAAACAAA
ATTGATTTGGAAGACGAGCGCAAGGTGAGCGCTGAGGAGGCTAAAGTTCTTGCTGATCAA
CATAAGATGCGCTATTTCGAGACGTCAGCAAGACTTAATAAGAACATTGATGAATTGATG
AACCACTTGATGGAGAAAGTTTACTAGAAAATGTTTTAAGATTAAGACGATGACAATAGA
GGAAAGAGCGTAGTGATAAACAAAAAGGATCATAAAAAGAGCGAAGGGACTGGTGGAAAG
AAAAATGGTGGTGGTGGTTGCTGCAAATGA


>Contig1379.1.g49(protein)
MAQKKIQIIILGDGAVGKTSLLRMYSEKQFTQSHMATIGLDYVSTTFKSPNTEDIAVKIW
DTAGQERFKTITYSFYKQAHGVIVTFDVTNQQSFNNVKTWLESIYQHADPSITKVLVGNK
IDLEDERKVSAEEAKVLADQHKMRYFETSARLNKNIDELMNHLMEKVYQKMFQDQDDDNR
GKSVVINKKDHKKSEGTGGKKNGGGGCCK