Identifiers and Description

Gene Model Identifier

Contig13731.0.g81

Standard Name

None

Aliases

Contig13731_0_g81

Description

CobW/HypB/UreG, nucleotide-binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001941504.0018838296491823e-56transcriptional regulator, Sir
2 family protein
SGDYNR029C2.9998215087698487e-30YNR029C SGDID:S000005312, Chr
XIV from 678488-677199, G...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13731.0.g81(coding)
ATGGAACAATCTGGAATGATGGTTGATGATAATGACGATATCATCCCAATCATTAAAGAA
GAGAAATCAAAAGTGATAATTATCACTGGATTCTTAGGGGCCGGAAAGACTACTTTAATT
GAATCAATACTTAAGCAACCAGTGTTAAATAAGAAAGTAGCTGTCATTTAAAATGAATTT
TCGGCTAAAATGGGATTAGAAAGCTCCTTGATGAAGGATTAAAATGGAGAAGATATTCAA
GACTTTTACGAGATGCCAAATGGATGCATATGCTGCGCAGCTAAAGATGATTTAATTCTA
ACACTTGATACTCTTCTGGAAAAAAAACCAGAACTAGAGTATATTTTAGTAGAGACTAAC
GGGTTAGCAGATCCAAGTCAGGTAATTCAAACTTTCTGGGTTGATGATGGTCTCTGCTCA
AAGATAGTTCTACATTAAACAATTGGAGTGATAGATACAGTCAACTTTGAGACCAAAATG
CAAAATCATGCACTTGTTAAAAATGAAGACGAACCTGCCTAATTTTCAGAAAGTGACTTG
CTATTAAGACAGCTAATATATGCAGATAAAATACTGCTTAACAAGATTGATTTAATCCAA
GAAGACAAGAAAGATGGATTATTAAAGAGTATTAGGGAAAAAGTAAAAGTACTCAATCCA
CAAGCAGACTTACAGGAAAGTAGCTATTCTTAAACTGGACTGGAATTTCTGACTGAAAAG
AATGTCAATAATGATTTCAGAAATCAAGATAAGTTTGAACAGTAAAATTGCTGTGCTCTT
GATACTCATGATCATAATCATTGCGATTCTTAAGATCACTCTCATGACCATAAATAAAAG
CATCATCATGATCATAGTGCAGTCGAAAACATACAATCAATATACATTAATGCCGATTTC
TAGACATTGATAAATTTCGATAAATTTGAAAAATTAATGGGTGAACTGTTATGGGAAGAT
ATGGACGATATGAGTATAATGAGGTGTAAAGGAACTTTTGTCGCAATAAATAAAGATTAG
GAGAGCAATTTATGGGAGTACATGCTTCAGGGAGTTATGAATACATTTGAGTTGAGAGAA
ATCCAAAATTATGAGCTGATAAATCATGCTTAAGTATATAAGCATCGGTTCCTATTTATT
GGCAAGAACTTAAATGAGCAAAAGTTAAACCTACTAATTAAGAAATGCTATGATGATTAA
AATCAATGA


>Contig13731.0.g81(protein)
MEQSGMMVDDNDDIIPIIKEEKSKVIIITGFLGAGKTTLIESILKQPVLNKKVAVIQNEF
SAKMGLESSLMKDQNGEDIQDFYEMPNGCICCAAKDDLILTLDTLLEKKPELEYILVETN
GLADPSQVIQTFWVDDGLCSKIVLHQTIGVIDTVNFETKMQNHALVKNEDEPAQFSESDL
LLRQLIYADKILLNKIDLIQEDKKDGLLKSIREKVKVLNPQADLQESSYSQTGLEFLTEK
NVNNDFRNQDKFEQQNCCALDTHDHNHCDSQDHSHDHKQKHHHDHSAVENIQSIYINADF
QTLINFDKFEKLMGELLWEDMDDMSIMRCKGTFVAINKDQESNLWEYMLQGVMNTFELRE
IQNYELINHAQVYKHRFLFIGKNLNEQKLNLLIKKCYDDQNQ