Identifiers and Description

Gene Model Identifier

Contig13694.0.g5

Standard Name

None

Aliases

Contig13694_0_g5

Description

TCP-1/cpn60 chaperonin family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYLR259C5.001208010698328e-102HSP60 SGDID:S000004249, Chr XI
I from 665002-663284, Gen...
T. thermophilaTTHERM_003382404.998282694803836e-101TCP-1/cpn60 chaperonin family
protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13694.0.g5(coding)
ATGAAGTATGGAATGGATGCAAGGTAAGCAATTGTTAAGGGAGTCTAAAGATTATCAAAG
ACTGTGTGTGTCACTCTTGGACCAGGTGGAAGAAACGTAGCATTAGAATATGAAGGAGGA
GAGCCACGTATCACAAAAGATGGAGTGACAGTTGTCAAGTCAATTATTGAACCCATCAGA
GAAGAAGACATGGGAGCGAGAATGATGAAAAGAATAGCAGGGAACACTAATACTTATGCG
GGATTTCATGCAGTTGAATTTGCAGGAGCTCATCCAATTGGTATTAAGAGAGGCATGGAT
AAAGCATTGCTCGTCGTGCTTGATTTCCTGAAAGAAATCTCAATGCCTGTGACTACTGAA
AAAGAAATTTATGATGTGTGCATGGTCTCCAGTAATTACAATTCAGAAATTGCTAGAATA
ATTGCACAAACAATGGATGCAGTAGGATTGAACGGAAATGTAAACATTGTTGAAAGTCCA
GTTGGAAAGAATAAGTTTAATTTAGTAAATGGACTCGTTTTTGATAGAGGTTTTGTTTCA
GAGACTTTTGTCACTGATCATAAAGTCGATCAAAGAGTTGAATTAGAGTTCCCATTAGTA
CTCGTAGTCGGTAATAAGATCAAAGATGTAAAGGATATATCTCCAATACTTGATTTAGTG
AAATCCACAAAGAGATCCTTTCTCTTATTTTCAGAAGATTTACAACCAGATCCATTATCT
ATGATGGTGTACAATAACTCTAAGGGAATAATATAATGTTGTGCAGTGAATATGCCTTGG
ATGGCTAATATGCAGAAGGACCTCTTAATGGATGTTGCCATTCAGACAGGAGCTACATAC
ATAGACAATGAATTTGAGAGGAAACTTGAGGATGTTAAAATCTCGGATTTTGGATCAGCT
AAGAAAATAGCTGTGGATGGTTTCACTACACACATAGTAGGCGGTAACGGTGATTAGAAG
GCTATAGACGACCGCATTTATGATATTCAAGTAAAAGCCGCCCAAGAAAAAAGTCCCCAT
ATAAAGCAAGTTTTAAGAGACAGATACTAGCGCATGACCTCAAAAATAGCAGAAATCGAA
GTTGGGGGTGGATCAGAGACTGAAAAGGGAGAAGTTAGAGATTTAATTGTGGATTCACTA
AATTCTGCTAAAGCTGCTATGATGAGCGGATTGCTTCCAGGTGGAGGAGTTGCTTTGTAT
TAAGCTTCAAAGATTCTTGAGAATGGCATCGATCATTTAGTGGATGATGAAAGCGAGAGA
ATGGGAGTGAGAGTAATGGCTGCAGCACTCAAGATGCCAATCAAGCTTGTAATTGAGAAT
AAAACTGGCCAAGATTGTGGGCACATTATAAATAAAATTGAGTCTTAAAATAGTATGTTT
GCTGGATTTGATTGCAAAACTGAACAAATTGTCGACATGGTTGACTCTGGAATAGTAGAC
AGCTTTAACGTGGTTAAAATCGTTCTCTAAGATTCTGTATCTCTAGCTGGATTATTGCTG
ACGACTGAATGTCTTGTAATCAAAGAAAAACAATACGAACCACTGCCATTAAGTCATTAT
CAAGAGAAAAGGGACTTCTTTTGA


>Contig13694.0.g5(protein)
MKYGMDARQAIVKGVQRLSKTVCVTLGPGGRNVALEYEGGEPRITKDGVTVVKSIIEPIR
EEDMGARMMKRIAGNTNTYAGFHAVEFAGAHPIGIKRGMDKALLVVLDFLKEISMPVTTE
KEIYDVCMVSSNYNSEIARIIAQTMDAVGLNGNVNIVESPVGKNKFNLVNGLVFDRGFVS
ETFVTDHKVDQRVELEFPLVLVVGNKIKDVKDISPILDLVKSTKRSFLLFSEDLQPDPLS
MMVYNNSKGIIQCCAVNMPWMANMQKDLLMDVAIQTGATYIDNEFERKLEDVKISDFGSA
KKIAVDGFTTHIVGGNGDQKAIDDRIYDIQVKAAQEKSPHIKQVLRDRYQRMTSKIAEIE
VGGGSETEKGEVRDLIVDSLNSAKAAMMSGLLPGGGVALYQASKILENGIDHLVDDESER
MGVRVMAAALKMPIKLVIENKTGQDCGHIINKIESQNSMFAGFDCKTEQIVDMVDSGIVD
SFNVVKIVLQDSVSLAGLLLTTECLVIKEKQYEPLPLSHYQEKRDFF