Identifiers and Description

Gene Model Identifier

Contig13677.0.1.g35

Standard Name

MORN1d

Aliases

Contig13677_0_1_g35

Description

MORN repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005667106.998681101626156e-126hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13677.0.1.g35(coding)
ATGAAAGCTAGAAAAGAATATAATAAAGCGAAAAAGTAAAAGCAGTAACACTCAAGTAGA
AGTATTCCAGGAGGCAGTGGAGGAGGAAGAAGATCAAATAGACCTGACTTGAAAAATGGA
GCTGCTATAGCACGTCAATTGAATGAAATGCCTGATTATAGCAATCCAGCTACTAAAGCA
ACTGAAGCTAAGTTGGGGAAATTTGAATACGATCAACCCTCATCTCCAAGCAGTAAGAAT
TTAATAGAGCGTGGCCCTTATGAACTTGATAACGGAGCTATATATGTCGGAGAGTGGACC
AAAGATGGCTTGAGGCACGGAAGAGGTCTACAAATTTGGAAGGATGGCTCTAAGTACGAG
GGCTACTGGAAAAATGACATGGCTAACGGAAAAGGAAGGCTTATCCACTCCGATGGTGAT
GTCTACGAGGGAGAGTGGCTTAACGACAAAGCTCATGGAAGAGGAACTTACATTCATATG
GACGGAGCTAAATATACCGGAGACTGGAGAGAGGACAAACAACATGGCTTTGGTGTTGAA
ACATGGCCAGATGGGGCTAGATATGAGGGTAACTACGAATATGGAAAGAAACATGGAACT
GGTACTTTCAAGTGGGCAGATGGTTCTATGTACATTGGTGAATTTTACAATAACAATATT
CATGGAAAAGGAGTCTATACTTGGAGTGATGGTCGTAAATATGAAGGAGAATGGAGAAAT
AATAAAATGCATGGTCGTGGAACATTTGCCTGGGCAGACGGTCGTAAATACGTCGGAGAG
TATGAAGACGACAAAAAGCAAGGTTATGGTGAATTCATATGGCCTGATGGAAGATCTTAT
AAGGGAGATTGGCTAAATGGTAAACAGCACGGAAAGGGTGTCTACATTACCAGTCAAGGA
GCTGAAAAATTCGGTGAATGGAAAGAAGGAAAGAGAATCAGATGGATTGGCAGAGGTGAA
GGCGAGCAATGA


>Contig13677.0.1.g35(protein)
MKARKEYNKAKKQKQQHSSRSIPGGSGGGRRSNRPDLKNGAAIARQLNEMPDYSNPATKA
TEAKLGKFEYDQPSSPSSKNLIERGPYELDNGAIYVGEWTKDGLRHGRGLQIWKDGSKYE
GYWKNDMANGKGRLIHSDGDVYEGEWLNDKAHGRGTYIHMDGAKYTGDWREDKQHGFGVE
TWPDGARYEGNYEYGKKHGTGTFKWADGSMYIGEFYNNNIHGKGVYTWSDGRKYEGEWRN
NKMHGRGTFAWADGRKYVGEYEDDKKQGYGEFIWPDGRSYKGDWLNGKQHGKGVYITSQG
AEKFGEWKEGKRIRWIGRGEGEQ