Identifiers and Description

Gene Model Identifier

Contig13637.0.1.g28

Standard Name

None

Aliases

Contig13637_0_1_g28

Description

Mitochondrial carrier protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam00153 ) Mitochondrial carrier protein
  • ( pfam13858 ) Protein of unknown function (DUF4199)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010183401.9994274381022833e-63Mitochondrial carrier protein
SGDYPR058W7.002116201343823e-26YMC1 SGDID:S000006262, Chr XVI
from 673751-674674, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13637.0.1.g28(coding)
ATGTATAGCTCCATTAAGGCTCTTGCGTTTTACAAGGGTATGTGCCCTCCTCTATTTACT
GTTCCAATTATTAACTCAATTGTATTTGCTTCTTATGAATTTAGTAAAAGATTAATGGGC
GTGCATGCTGGACAAGACTACACTTTTAAATAAAGTTTGATATCTGGAATGTTTGCTGGT
TTCGTCAATAGTTTCGTGCTCTCACCTATAGAGCTAGTTAAATGTCGTTTATAAGTATAG
AGAGAAGATAAGGCACATGCTTACTACCGTGGACCATTGCATTGTGTGAAGAGAATTATT
AAAGAGGAAGGCTCAAGAGGCTTATACAAGGGACTACTGTCTACTATATCCCGAGAGACA
CCATGCTATGCAGGTCAATTTGGAGGTTATTTTCTTACTAAAAAATCGCTGGCTTGGCTC
TAAAAGAAAGATGTTCATGATCTTGGTCATGCATCTTTATTCATAGCGGGTGGAGTGGGA
GGCTTCACTTGCTGGCTTGTCTCATATCCCTAAGATATTATTAAAACTAGACTTCAGGTT
GCTAGGAGCCAAGAATTTGCAAATTATAACAGATATATAAGAGACGGGGGAATGATTGAA
TGTGCAAAATACATCTATAAGAACGAACATGGATTTATGGGTTTTTGGAGAGGGTTCTCA
GCTTGCAGTGCAAGAGCAGTTTTTGCAAACTCTTTCATGTTTGTGGCTTATGAATATGCT
TAGAAAAAAGCAAGAGGGATAATTGAATGA


>Contig13637.0.1.g28(protein)
MYSSIKALAFYKGMCPPLFTVPIINSIVFASYEFSKRLMGVHAGQDYTFKQSLISGMFAG
FVNSFVLSPIELVKCRLQVQREDKAHAYYRGPLHCVKRIIKEEGSRGLYKGLLSTISRET
PCYAGQFGGYFLTKKSLAWLQKKDVHDLGHASLFIAGGVGGFTCWLVSYPQDIIKTRLQV
ARSQEFANYNRYIRDGGMIECAKYIYKNEHGFMGFWRGFSACSARAVFANSFMFVAYEYA
QKKARGIIE