Identifiers and Description

Gene Model Identifier

Contig1359.1.g24

Standard Name

None

Aliases

Contig1359_1_g24

Description

Parkin co-regulated protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004995707.001959534329768e-108hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1359.1.g24(coding)
ATGGAATCAACTGGAAAGAAGTTAGGTTTTACAAACGTAAAAGGCCATAAAATTATCACG
AAATGTGCTGGTATGGGAGGAAATTCCTCAAGCATCGCTGCTAAAAAAGCACAGTCAGTC
CCTAAAAAGCCCAAGACTGGCATTTTCGAAGCAAAAGCAGTGATACCAAGCACCATCTTT
AAGAAATGCTATGATAGAGGGGATTTACCAATCGTTGTAGACTTTATCGGAGCTCATAGA
AAAATTGCATGGAAAGTTGAAGTGGACCTTCTCGATTACCATCACTACTTGCCAATATTT
TTCCATGGTCTCCGTGAAACCGAAGATCCCTATAAATTCCTCGCTGACTAGGGTTTAAAC
GCACTTATTTAATTCGGCAAGGAGAAGATCTTACCAGTGCTCCCTCAATTGATCATCCCA
ATCAAAGAGGCACTCAGCACAAAAAATCATGAGATTGTTGTGAAAACTCTTAGAAAGTTG
CAAGCTTTGGTTAAAGTTTCAGAAGCTGTAGCTGAAAGTTTAGTGCCATATTACAGATAA
ATCTTGCCCATTTTCAATCTACTCAGACATAGAAACACCAATTTGGGAGATAAAATCGAC
TACGGTCAAAGAAAGGGTGATAATGTTGGAGATTTAATCCAAGAGACATTAGAACAATTT
GAGAAGCACGGAGGAGAAGATGCTTATATCAACATTAAATATATGATACCCACTTATGAA
AGCTGCATGTTTTGA


>Contig1359.1.g24(protein)
MESTGKKLGFTNVKGHKIITKCAGMGGNSSSIAAKKAQSVPKKPKTGIFEAKAVIPSTIF
KKCYDRGDLPIVVDFIGAHRKIAWKVEVDLLDYHHYLPIFFHGLRETEDPYKFLADQGLN
ALIQFGKEKILPVLPQLIIPIKEALSTKNHEIVVKTLRKLQALVKVSEAVAESLVPYYRQ
ILPIFNLLRHRNTNLGDKIDYGQRKGDNVGDLIQETLEQFEKHGGEDAYINIKYMIPTYE
SCMF