Identifiers and Description

Gene Model Identifier

Contig13499.0.g54

Standard Name

None

Aliases

Contig13499_0_g54

Description

Dynein light chain type 1

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007162504.999723464643358e-28hypothetical protein
SGDYDR424C0.000000030002053728821195DYN2 SGDID:S000002832, Chr IV
from 1319617-1319387,1319...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13499.0.g54(coding)
ATGGAATTGCCAGCACTTAACCTCGATGATTTCACAAAGTGGAAGCAAGGTTTCCCTATT
GTTAAGGAAACCGATATGGATGAAGATATAGCAACAGAGGCAAAAGAATTCGTTACTTCA
GGAATTGAAAAGGCTTCAGGTCAATTCGGTATCAATATAGAGATTGCATGCAAATTCGTG
AAAGATCAAATGGACAGATAATTCGGTCCCTCATGGCACTGCGTGATGGGAGAGGGTTTC
TCTTTCGAAGTGACGAGACAAGCAAAGACAACTCTGTACATGTACTACGCTGGAAAAATC
TGTGTGCTTCTATTCAAATGTTGA


>Contig13499.0.g54(protein)
MELPALNLDDFTKWKQGFPIVKETDMDEDIATEAKEFVTSGIEKASGQFGINIEIACKFV
KDQMDRQFGPSWHCVMGEGFSFEVTRQAKTTLYMYYAGKICVLLFKC