Identifiers and Description

Gene Model Identifier

Contig13440.0.g106

Standard Name

None

Aliases

Contig13440_0_g106

Description

ATP synthase subunit D

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

  • proton-transporting two-sector ATPase complex, catalytic domain (IEA) | GO:0033178

Molecular Function

  • ATPase activity, coupled to transmembrane movement of substances (IEA) | GO:0042626
  • proton-transporting ATPase activity, rotational mechanism (IEA) | GO:0046961

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008218701.99927841627239e-68V-type ATPase, D subunit famil
y protein
SGDYEL051W2.0004062814618821e-57VMA8 SGDID:S000000777, Chr V f
rom 58378-59148, Genome R...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13440.0.g106(coding)
ATGTCAAAAGCTATCTTGCCCTCAAGAATGAACTTGGCTGTCTTCAAGCAAAAGAAGGTC
GGAGCCAAGAAGGGTTTCGATTTATTGAAGAAGAAGTCTGATGCACTCAAGAAATCTTTC
AGAGAAATCTTATCCAAGATTCTTGAGACAAAGAAGAAAATGGGTAAGGAGTACAATGCC
GCCTTGATCGCATTGGCAGAGGCTAACTTCGCTGCTGGAGATTTCTCCAAGTCAGTCCTC
GACTCCGTGAAGACCAGAACAAACGTGAGATTGAATGTGACCTCAGAAAACGTGGCTGGT
GTTCACTTGCCAATCTTCACTTTGAGAGGAGATGCTGACGATCAAGGTGATGATAGACAA
ATGCTCGGTCTTACTGGTGGTGGTCAAGCTATTCAACGCTGCAAAGAAAGATTCCAAAAG
TTCCTGAAGATATTAGTAGATATCGCTTCTCTTCAAACCCAATTCATTACCCTCGATGAG
GTCATCAAGGTCACCAACAGAAGATGTAATGCCCTCGAGTACGTCGTCATTCCCAGAATT
GAATTCACCATTAACTACATTGACAAGGAGTTGGACGAGGAAAGCAGAGAAGATTTCTTC
AGACTAAAGAGAGTCACAGATAACAAGAAGAGCGAGAAGCTCGAGCAGCAAAAGCAGGCT
GACCTCAGAAGCAATAATGCCGGCTAACAAGACCAACAAGAGGAAGGTTCAGAGTCTATT
TTTGGAAACGAAGAAGAGGAGGATCTTTTATTCTGA


>Contig13440.0.g106(protein)
MSKAILPSRMNLAVFKQKKVGAKKGFDLLKKKSDALKKSFREILSKILETKKKMGKEYNA
ALIALAEANFAAGDFSKSVLDSVKTRTNVRLNVTSENVAGVHLPIFTLRGDADDQGDDRQ
MLGLTGGGQAIQRCKERFQKFLKILVDIASLQTQFITLDEVIKVTNRRCNALEYVVIPRI
EFTINYIDKELDEESREDFFRLKRVTDNKKSEKLEQQKQADLRSNNAGQQDQQEEGSESI
FGNEEEEDLLF