Identifiers and Description

Gene Model Identifier

Contig13350.0.g51

Standard Name

None

Aliases

Contig13350_0_g51

Description

Glycosyltransferase family 20

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYDR074W4.000989088096131e-71TPS2 SGDID:S000002481, Chr IV
from 593893-596583, Genom...
T. thermophilaTTHERM_000773906.996603630663804e-52trehalose-phosphatase family p
rotein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13350.0.g51(coding)
ATGATGAATAGAAAAAATACTCAAAAAGGCCCTAATGACTCAAATAATAGTCCAAGTCTG
GAGGATTCAGAAGAATAAAATAAATATGATTTGAAGATGCAGACGCAGTCGATCTATGAC
AAAGACTATTTTGGTTATGGAGGTAGTGGTGGAGCCGTGAATCACAGCATGCCTTACATG
GAATTTGACACAATGAATCGCTACACCTAGGGATATAGACATAGAATAACAATCCTCTTC
AAAGTTTAATGCAGAGATACATAGCTGGGAGATGCACTTAGAGTAACAGGATCTTGCTTA
GAACTAGGAAATTGGAATCCCATTAATAGTATCGTTTTGACTACTACCCCTAAAGATTTC
CCTTTTTGGTAAGGATATGTCGCAATAGATCCTCATAATTTGCAGGAACGAAACATTTTG
CAGTACAAATATGTGATATGTGTGGAATCAACAAAATTAGCTAAAAAGTGGGAACCACTT
CAGGGAAATAGAATCATTGATTTATTGCATAATAAGGAAGTCATTATTGAGGATATATTT
GGTCAACCAAATCACTTGAGGGAAGAATTAACACAAATCCAACCTTCCTCAATTTAAAAA
GATGACTTAAGTTCAAACACAGAAAAGGTATCCGCGGATTTTGGCTCATCTGATTTCTTA
TGTGAAAGTCCAGGCTATGGTTAAAAAATTGTCAAGAAAGTCAGGGAACTCAAAAATGTA
GCAGATCAATATTAACAAATCAAGTAATAGAAGAAATAGTTCTCGAATCAGAAATAAGAC
AATCTGATGGGAACAAGCGGTACTGGTAACACAGGAAGTAAGAATTATCAGCAAATGGAT
CAGCATGTATACTTGAGATCTGAATCCTTGACTCAACAAGAAAAGCAGGAGCTAATGAAA
CATTTATCAGGCTCGTTGGAATCCCCAGTAAAATAATAAGAGAGAATTTAAAAGGATTCA
CACATTCATGCTCCAGCTGAAGTTCTTGCACAACGAAGAAAAATCAGTGATTGTGCAGTT
GATGTTGACCACTTGGGTTTCGATGCTAAAATGCTCAGATCACTGCAGGATGTTTAATAA
ACCAGAATGGAATACCTTAGAGCCACTTAGCTCTAATAGTTTAACACGATTAAGGATTCA
AGGTTTAATATGGGGTATTACGATGAAGAGGGCGATCAAAATCTACGTACCTCAGAACAT
TTAAAGTCTGGAACATAACCTCATTTTCCTGTAAAAACTCCTTCTGGACACCTTTTACAA
TCAGATGGTGAAGAAAGTCTCACAGATGAAGATGATGGTGATGAAGACGACACTATGCTA
CAGGACGAAGATAGAAACCTATTTACTGATGTAAAAATAACTCCAGACGATATGGTAATT
GTAGCAAGTTTCAAACTGCCCATTAGTTTAGACAGAGACCCAAGTTCCCCCAGCGGCTGG
AGAGTGAGAAACTCACGATCTTTGTTGTACCCCACTATGTTTAAGTTGAGAGAATAGTCA
CGTATGGTTAAAATTACTTGGATAGGGTGGCCTGGAATTATACCTGAGTCTCCAGAGGAA
CAACAGCAAATCACTGAGTTATTGAAGGAGTATGGATGTATTCCAGCATTTTTCGATGCT
GAAACCATTGAATAGTACTTATATTATCATGAAACTGTGCTCAGGCCACTCTTTCATAAT
TTCAAGGGACTCAATGATTTTGAGCACCTGGGTAAACAAGAGCATTGGCAGAAATACTAA
TTCGTTAACTCTAAGTTTGCAAGCATCATCCGAGAAATAAAATAAGAAAAAGAGATGATT
TGGGTACATGACAATTATTTGCTGTTAGTGCCCACGTATGTTATTAGAAAAGATATTGGA
GCTAATATTGGGTTTTCGATGCACTGCCCTTTTCCCTCCTCAGATATTTATAAAATGTTT
CCTTATAGAGGTGAAGTTCTTAAATCTCTCTTGTCCTGCAGCTTGATAGGTTTTCATTAA
TTTGAATATGCTCGTAACTTTTACACTTCATGCAGACGTATCTTAGGACTCAATCATGAA
TTTAAGAAGGGTGGATTCCTCGCAATTGAGTGTTTCGGTAGGAGTGTGATGCTTAGAATT
TCTCATATAGGTATAATGGAGGACGATATTGTGGCAATGATGGAAACAGAATAGAGCAAA
AACTTTGTCAAATACCTCACAAAAAATATAATAGGGAGAAAGAAACATGTAATATCATCA
ATCGACCGCTTCCACCCAATATCTGGCCTGAAAAATAAACTGCTGGCTTACTAGAAGTTC
ATGAGAGAATACCCTATATATAGAAACCACACCTGCCTAATTTAATTTGTCATACCATCA
GATTGCCCTAAGTGTTAGCAGATTCAATGCTCTCACCAAATAATAAATCAAACTCGTTAA
GAATTGTTGACATTAGTCCAATAAATATAGGATGAATTTGGCAAGACCAGTCTCCATTAC
GTGGAACAAGACTTAACTATGGAGTAAAGAATGGCTTTATGGAATGTAACAAACATTCTG
TTGATCACCACACTAAGAGATGGTCAGTGCTTACCTCCACTTGAATTCATTACAGTCAAG
AAACACTCAAATAAGAGCAACAAAGCAGCAGTTATTTTATCTGAGTTTTCTGGCTGTAAC
AGAGCCCTTGGTGGAAACTTAAAGATTAATCATATTTCTAAGTGCCAAACATTCGTTAAT
CCCTTTAACGTGGATGAAATATCAAGAAACATAGACTTAGCATTCTAAATGACCCCTGAG
GAGAAGGAACAGAGATTCAAGCTCGCTTACAATTATATATCAAAGCACTCGACTCTCAAG
TGGGCTGAAGCTTTTATTAAGGATTTAAAGAGATCACACATGACTGTTGGTGAGAACTTA
AGCAACTACATGATAATAGGTTTCGGTTTGAATCAAACTATAATTAAAACCAGACAGGGT
TTCAGTGAATTGAAAGAGTCCATAGTGGAGGCAAACTACAGTCGAGGAGTCAGCCGACTA
ATTATCATTGATCAAGAGGGAGTTTTACCAATGAAAGGCAATGTAAACAAATAGCTGCAG
GAACCTTCATCCTCAGTGATTGAGTTATTGAATTAATTGACTAGAGATGATAGAAATCAG
GTATTTGTCATCAGTTCAGAAGTTAAATAGTTAATGCATAAGTGGTACTCTGAGAAAGCT
CCAAAATTAGGTTTAGCTGCTGAAAATGGATTTTTCTGGAGAACAGACAGCGAGGGCAAG
GATGAGCACACCTGGGTTAAACTTCTGCCTAAAGTAGTTGATTTCTGCTGGATTGAATCA
GTCAGAGATATCATGCAGAGTTATACTGAGAAGACAGACGGTGCCTTTATCGAAGAAAAA
GAAGCCATGATTATTTGGAATTATAAAGATACTGATCCTGAGTTTGGAAACTGGCAAGCA
AAAGAATTGACATCACACTTAGAACATGTTTTCTGCAATTTGCCTATTGAAATCATACAT
GGAAAGAAATGTTTAGAAGTGGTGCCAAACTAGTTGAAAAAGGTTAAACTTGTGAAATTA
TTACTAGAGTCACTCTCTAAGAAATTCCCATTTGATTTTGTTCTATATATCGGAGATGAA
ATAGGGAATGAGCCAGTCTTCACCTATTTGAACAACAAGAAGCACCAAAACTCCAAGGCA
CTCTCAGGGATGGCGAGTGTTTACACCTGTACTATTGGAAGGAAAGTCACCTAGGCCAAA
TATTTCCTGAATGAAATGGATAACGTAGTGCACTTATTGGAGCAACTACTAAGCAGCACT
TTGGCTTAATAAAGAACCAAATCTTTCGCAGAATTGAGAAAGAATGAAGCAACCAATAGA
AGTGGAATGCTCTTATCAAGTCAAAAGAAACCTAACCACCCAGCTGGAGGTGGGCATAAT
GATAATTCCTTGAAAAGAACAGGCACTTAATTGCTATACAACAACGCTCATAATTTCTAG
TAAGATAGTAAAAATCAAGCACCAAAGGCAGGCAGTGGCATACTTCTAGCTGCTAATGAC
TTCAATGACTCTCAATCAGAGGAAAGCGACAGCTTCATTAACTCAGGCAATTCTTCAAAT
AACGACCTCAATTCGCAATAAGAAGCACAGATGTACAATAAATATCTCACTATGAAAACA
CCACTCAAAAACTAGAAAAAGTTGTGA


>Contig13350.0.g51(protein)
MMNRKNTQKGPNDSNNSPSLEDSEEQNKYDLKMQTQSIYDKDYFGYGGSGGAVNHSMPYM
EFDTMNRYTQGYRHRITILFKVQCRDTQLGDALRVTGSCLELGNWNPINSIVLTTTPKDF
PFWQGYVAIDPHNLQERNILQYKYVICVESTKLAKKWEPLQGNRIIDLLHNKEVIIEDIF
GQPNHLREELTQIQPSSIQKDDLSSNTEKVSADFGSSDFLCESPGYGQKIVKKVRELKNV
ADQYQQIKQQKKQFSNQKQDNLMGTSGTGNTGSKNYQQMDQHVYLRSESLTQQEKQELMK
HLSGSLESPVKQQERIQKDSHIHAPAEVLAQRRKISDCAVDVDHLGFDAKMLRSLQDVQQ
TRMEYLRATQLQQFNTIKDSRFNMGYYDEEGDQNLRTSEHLKSGTQPHFPVKTPSGHLLQ
SDGEESLTDEDDGDEDDTMLQDEDRNLFTDVKITPDDMVIVASFKLPISLDRDPSSPSGW
RVRNSRSLLYPTMFKLREQSRMVKITWIGWPGIIPESPEEQQQITELLKEYGCIPAFFDA
ETIEQYLYYHETVLRPLFHNFKGLNDFEHLGKQEHWQKYQFVNSKFASIIREIKQEKEMI
WVHDNYLLLVPTYVIRKDIGANIGFSMHCPFPSSDIYKMFPYRGEVLKSLLSCSLIGFHQ
FEYARNFYTSCRRILGLNHEFKKGGFLAIECFGRSVMLRISHIGIMEDDIVAMMETEQSK
NFVKYLTKNIIGRKKHVISSIDRFHPISGLKNKLLAYQKFMREYPIYRNHTCLIQFVIPS
DCPKCQQIQCSHQIINQTRQELLTLVQQIQDEFGKTSLHYVEQDLTMEQRMALWNVTNIL
LITTLRDGQCLPPLEFITVKKHSNKSNKAAVILSEFSGCNRALGGNLKINHISKCQTFVN
PFNVDEISRNIDLAFQMTPEEKEQRFKLAYNYISKHSTLKWAEAFIKDLKRSHMTVGENL
SNYMIIGFGLNQTIIKTRQGFSELKESIVEANYSRGVSRLIIIDQEGVLPMKGNVNKQLQ
EPSSSVIELLNQLTRDDRNQVFVISSEVKQLMHKWYSEKAPKLGLAAENGFFWRTDSEGK
DEHTWVKLLPKVVDFCWIESVRDIMQSYTEKTDGAFIEEKEAMIIWNYKDTDPEFGNWQA
KELTSHLEHVFCNLPIEIIHGKKCLEVVPNQLKKVKLVKLLLESLSKKFPFDFVLYIGDE
IGNEPVFTYLNNKKHQNSKALSGMASVYTCTIGRKVTQAKYFLNEMDNVVHLLEQLLSST
LAQQRTKSFAELRKNEATNRSGMLLSSQKKPNHPAGGGHNDNSLKRTGTQLLYNNAHNFQ
QDSKNQAPKAGSGILLAANDFNDSQSEESDSFINSGNSSNNDLNSQQEAQMYNKYLTMKT
PLKNQKKL