Identifiers and Description

Gene Model Identifier

Contig13304.0.g94

Standard Name

None

Aliases

Contig13304_0_g94

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00069 ) Protein kinase domain
  • ( pfam00659 ) POLO box duplicated region
  • ( pfam07714 ) Protein tyrosine kinase
  • ( pfam01636 ) Phosphotransferase enzyme family
  • ( pfam00217 ) ATP:guanido phosphotransferase, C-terminal catalytic domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001917909.997093137033517e-262Protein kinase domain containi
ng protein
SGDYMR001C5.999967307255342e-97CDC5 SGDID:S000004603, Chr XII
I from 271136-269019, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13304.0.g94(coding)
ATGTAGCAATAGCAATAAATAAATCCACATCAATAAACAGCAAATAATAATGATGAAGGT
ATTAATACTATTGTTGAGGAGAAAATTATTAAATCTAATGGGGACACTCTTATCAAAAGA
TATCTAAAAGGAAAATTCTTGGGGAAGGGAGGTTTTGCGAAATGCTATGATTTTACCAGT
TTGGACACTAAGAAGTTATTAGCTGCAAAAATTGTTCCTAAAGCATCTTTATCTAAAAGC
AGAGCAAAGTCAAAGTTAATGAGTGAGATCAGAATCCACAGATCTCTACACCACTAAAAC
GTAGTTGGTTTCGAACATTTCTTTGAGGATGCTGAAAATGTGTATATTTTATTGGAACTG
TGTCAAAATCAAACATTAAATGAAATGGTAAAGAGGAGAAAGAGATTGACTGAGTTAGAG
GCTTAATGTTATGCTTTGCAAATAATTTCTGCTTTAAAGTATCTGCATGCGCATAGAGTC
ATTCATAGAGACTTGAAGCTAGGTAATTTGTTCCTCACTGATAAAATGCAAATCAAAATT
GGTGACTTTGGACTAGCATCAAAATTAGATTTCGAAGGAGAGAAAAAAAGAACAGTGTGT
GGAACACCAAATTATATCGCTCCAGAGATTTTAGAGGGTAAAAATGGACACTCATATGAA
GTTGATATATGGTCATTTGGTGTAATTCTTTATACTCTGATAATTGGGAAGCCGCCATTT
GAGACTCAGGATGTCAAAACCACTTATAGAAGGATCAAAATGAATGCTTATTCATTTCCA
GAATCAGTGACTATCTCAGATGAAGCAAAATCCCTAATAACTTTGATTTTAAATTTGGAA
CCTACTAAGAGACCCTCCCTTGATGAAATATTAGATCATAATTTCTTTCATAATGGCAAT
ACTATACCAAAGCTGTTGCCTGCAAGTACACTTGCATGTCCTCCTTCTTAATAATTTATC
AAGCAATTCATGGGTTCTGCCATAAGTCATTAAGACATGAGTAAACCTCAAGGCAGGTTT
GAATCAACAGCTCCTGTATAGCCTCACAGTGCTCTTAGAGAAGGACAAAATAATTTCAAT
GCAACTGACCGCTTCAAATAAAGTGATAAGCCCTAAACTTCACAAGGATAAAGAAACCAA
ATTAAAGCTAATTAATCAAACGGGCCAGATGTTTGGGTTAAGAAATGGGTGGATTACTCT
TCAAAATATGGTCTTGGATATCTTCTCTCAAATGATGCTAACGGAGTATTCTTTAATGAC
AATACCAAGTTAATCTTAGACCCTAAGGGCTTTTACTTTGATTATATGGAGCGCAGAGGT
GCAGAAAAATAGGATTTTATGTCAAGTCATACACTCACTGAATACCCCAAAGAAATCCAA
AAGAAAGTGACTTTACTACTACATTTCAAAAGTTATCTAGAAAGTGATTAAAAACCTGGG
GAGTTGGTGAAAATTTAAAAAGATTAGGAGCACTTCAAAGATCACAGTAACACTGTTAAG
ACTTAGGGAGCTCCAATTTATGTGAAGAAATGGATGAGAACTAGACATGCCATTATGTTT
AGACTCTCAAATAAGATAGTATAGGTGAATTTCTAGGATCACACAGAAATTATACTGTGC
AGTGAATCGAGACTAGTTACATATGTGAATAAAAAGGGAGAGAGATAGACATTTAGTTTG
CAGATTGCGCTTGAGAGTACCAATTAAGAGATGAGTAAGAGGTTGAAGTACACTAAGGAC
ATACTAAGTCACATGATAAGTTTGAACACTGGAGGGAATGTAAAATAGCCAAATGGTAAT
ATATGA


>Contig13304.0.g94(protein)
MQQQQQINPHQQTANNNDEGINTIVEEKIIKSNGDTLIKRYLKGKFLGKGGFAKCYDFTS
LDTKKLLAAKIVPKASLSKSRAKSKLMSEIRIHRSLHHQNVVGFEHFFEDAENVYILLEL
CQNQTLNEMVKRRKRLTELEAQCYALQIISALKYLHAHRVIHRDLKLGNLFLTDKMQIKI
GDFGLASKLDFEGEKKRTVCGTPNYIAPEILEGKNGHSYEVDIWSFGVILYTLIIGKPPF
ETQDVKTTYRRIKMNAYSFPESVTISDEAKSLITLILNLEPTKRPSLDEILDHNFFHNGN
TIPKLLPASTLACPPSQQFIKQFMGSAISHQDMSKPQGRFESTAPVQPHSALREGQNNFN
ATDRFKQSDKPQTSQGQRNQIKANQSNGPDVWVKKWVDYSSKYGLGYLLSNDANGVFFND
NTKLILDPKGFYFDYMERRGAEKQDFMSSHTLTEYPKEIQKKVTLLLHFKSYLESDQKPG
ELVKIQKDQEHFKDHSNTVKTQGAPIYVKKWMRTRHAIMFRLSNKIVQVNFQDHTEIILC
SESRLVTYVNKKGERQTFSLQIALESTNQEMSKRLKYTKDILSHMISLNTGGNVKQPNGN
I