Identifiers and Description

Gene Model Identifier

Contig13224.0.1.g9

Standard Name

None

Aliases

Contig13224_0_1_g9

Description

E2F/DP family winged-helix DNA-binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam02319 ) E2F/DP family winged-helix DNA-binding domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000164000.0000000000499999055251093Transcription factor E2F/dimer
isation partner

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13224.0.1.g9(coding)
ATGGAAGATATTTTACAATATTCTAAGATTCTTCCCATCCAATAGCATTAATTCTAATGC
TCAATCAAAGAGTCAGATAAGTCCAAGTTTCTCAAAGATCTTCTTCAACCAGAAAGTTTG
AAATCATCTTAATCTATGCAGGAGCAACTTACACTATCAAGCTCAGCTAGAAAAATGTTG
GAGACTGTCCTTAAAAACTCTAACATAAATGCCGTGCCTTAAACTCCACATGACTACACT
TTGTAAACACTGGATGTTTTAAAGAACAAAGACTTAAGTAACATGAATGTTGCAAATATA
GTAAGAGCATTAGTTGATACAATATAATATGATACGAAACTCGAGTAACTAGTAATCAAT
GAGTTGGGATTTTAGACACATAGCAGAATTTTTCAAACTAATGGCTTTATAACTTCTGAT
CTCTCAAGCACTCCTAATAAACAAGTTTAAGACCAAAACTAAAATGACTTTGATATTGGA
CTTGTATCTCTGGGCTAGTTTATGCTAGATTTTGGAAGAATTTTTCAAATCTTTAGTCCT
CATGAAGTTACGTTCTAATAAATACGAAAGCTTATAAAATTCAACCACATCATTTACAGC
AAATTCTAAACAGATAGCCATCTCGATTTCTTGAAGATTTAAGAGTCTAATAAATAATCA
TCACTTATTAGCCCTGTCGTAGGATTAGAGCAGCTGAAAGAAGCCAAATAGTATGAAGCT
GCTTAAATTACGAAGATATTTGAGGATTCTCAGCTTAGTTACCTTAAAACAAAAGGAGAT
CTATATGAGACTACTGAATATAACCCAAGTTTGATTGCAGGAATCGAATCTAAACACTGT
CAAAGTTACGATGATCTTCTAGCTCATGAAGACTTAAGCTCTATTAACTAATAAGTAAAA
TTAACAATGACAAGGGCTCAGTCATTTTAAGTTGGTTATAACAACTATCCTTAAAATAAC
TCACTTGGCTTCTCGTAGTAAAATAAAAGATATCCAGAGTATAATGGTTTTCAACCTTTA
CTAAACTAAAAGCATAAGCAAATAATTAATGAAAAATTGCAAATCCAACAAAAACATTAG
AACTAAGGTCGTGCATTGCTAAAAAATGAGATTCATGAAAAAATAGAACTAAATACCAAA
TAAGAGGATAATTTTAGATTATAGTAAAACCAGACTCCAAAGGTTCTCTCATTCAGTGCG
AATAAGCTAAAATCTCCTAGTTTGATTCAATCGTCAGTTTAGTATGTTGGCAATAAGCGA
TTTGGAGACCAGTCAACTGAAAAGCTTGAATTAAATATTAAATAAGAGGCTACTGCATAA
AAGAATCATTTCATAACTCCTATTACTAAAAGATAGAGGTTCGAGCCTCAATCATCCATG
TCAAAAGGATCACACTATCCAAAAGAAGAAAAAACCTTAGAAAATCAGCATAGTTCAGAC
AGTGAAGAGGAGGAAAAGCTACCTCATAATGGTCTAAGTCCTGATTAAAACGAAAGTGTG
CTTGAAGTAAATGACGCTGCATCTTCTGCTAGTCGTAAGAAAAGAGGACTTAAAATTTTA
AGTGTTAAAGTGCAGGAATTGGTATTCAAGAATCAGCACACAACCTATAAAGATGTTGCA
AATGAATTAATAAAGTAGTTGAGAGAGAAAAAGTAGAACAAAGAAGCAGGAGTTGATGAC
TTAATTGATGGAGACTCAGGGGATGATGAGGATATATCTGAAGATGCCTCACCAAATAAG
AAGAGTGATAGAGATCCCTCGTCATCACAATAAAAGTGGGAAAAGAACGTCAGAAGAAGA
GTCTATGATGCACTTAATGTATTATACGCTGCAGGAGTCTTGAAGAAGGAAGGAAAACAT
GTATATTGTGACAAATAAGTTCTTAAACTTACAAACAAACTTAAAGATAACTCATCAATA
TACTCATCTAACAGCAAAAGCTTTCTAGTAACAAAGAATAGAGCAAAAGCGTGA


>Contig13224.0.1.g9(protein)
MEDILQYSKILPIQQHQFQCSIKESDKSKFLKDLLQPESLKSSQSMQEQLTLSSSARKML
ETVLKNSNINAVPQTPHDYTLQTLDVLKNKDLSNMNVANIVRALVDTIQYDTKLEQLVIN
ELGFQTHSRIFQTNGFITSDLSSTPNKQVQDQNQNDFDIGLVSLGQFMLDFGRIFQIFSP
HEVTFQQIRKLIKFNHIIYSKFQTDSHLDFLKIQESNKQSSLISPVVGLEQLKEAKQYEA
AQITKIFEDSQLSYLKTKGDLYETTEYNPSLIAGIESKHCQSYDDLLAHEDLSSINQQVK
LTMTRAQSFQVGYNNYPQNNSLGFSQQNKRYPEYNGFQPLLNQKHKQIINEKLQIQQKHQ
NQGRALLKNEIHEKIELNTKQEDNFRLQQNQTPKVLSFSANKLKSPSLIQSSVQYVGNKR
FGDQSTEKLELNIKQEATAQKNHFITPITKRQRFEPQSSMSKGSHYPKEEKTLENQHSSD
SEEEEKLPHNGLSPDQNESVLEVNDAASSASRKKRGLKILSVKVQELVFKNQHTTYKDVA
NELIKQLREKKQNKEAGVDDLIDGDSGDDEDISEDASPNKKSDRDPSSSQQKWEKNVRRR
VYDALNVLYAAGVLKKEGKHVYCDKQVLKLTNKLKDNSSIYSSNSKSFLVTKNRAKA