Identifiers and Description

Gene Model Identifier

Contig13179.0.g39

Standard Name

None

Aliases

Contig13179_0_g39

Description

Ubiquitin family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00240 ) Ubiquitin family
  • ( pfam13768 ) von Willebrand factor type A domain
  • ( pfam11976 ) Ubiquitin-2 like Rad60 SUMO-like
  • ( pfam13519 ) von Willebrand factor type A domain
  • ( pfam00092 ) von Willebrand factor type A domain
  • ( pfam13757 ) Vault protein inter-alpha-trypsin domain
  • ( pfam08487 ) Vault protein inter-alpha-trypsin domain
  • ( pfam05762 ) VWA domain containing CoxE-like protein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002852604.998978211117678e-38von Willebrand factor type A d
omain containin...
SGDYKR094C8.003613776907505e-34RPL40B SGDID:S000001802, Chr X
I from 618374-617996,6187...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13179.0.g39(coding)
ATGGAAACCCATAGCTTAAAAGAAATACTCGCATAGAATAGCACAAATGCTATGTTTTTG
ATAAACAAATAATCAAAACACCCTATTCCCCTAACTAAAGTCGATATCTTCGCAAATGTA
GTCTAGTAGCTGGCTTCATTCGAGATGAGACAACATTACGTTAACATTGAAGATATCCCC
ATTGAAACAATTTATCTCTTCCCAGTTGATGTTGATTCTGTTTTTACAAACCTCGAGATT
GAATTCACTCTTCAAGATGGGTCAAAGAGATAACTCATCACTAAGGTTGACCTCAGGGAG
AAAGTTCAGGTCAAATACGAAGAAGCCGTCGCATCAGGAAAGACAGCCATTGTTGGATCA
TTCACAAAAACTTAAAGAGACATGGTTAGAGTTGTCATTGGAAACTTCCCACCCAACTCA
TCAGCAGTAGTCAAATGTTTCTTCCATTCAAAGTTAGACATTGAGGACATTAGCTACTGC
TTAAGGCTACCAATGAGTTATGTGCCAAGATATATGGGCGATATATAGAGATACATTGAC
ACTGGTGTGATGTACAAGGGACAATAACCAACTTAATCACAGCCATTAACAGAAGAATAA
AAATCTCAAAATATCCAAAATATCATGGAAATAGTTGACCAACCTATGATGGATGCTACT
TCAGAGAACGCTCCTTACCTCTGGAATCTCCACCTTAACATTCAAATGGCTGGAGAGATC
TAAAGAATCTCATCCAGAAATCATTCGATTTAAATCAAGAACGTATCCAATTCTGGATTT
GGATCTTCTGCTTAAGTTACACTTGGAGATGCAGTTCGTAATCATGTACCAAACAAAGAT
TTTATTCTCTACCTCAGAGATGATACAATAGGTTAACCAATAGCAATTAAGACTAAGAAT
TAGTATAACGAAAATGCTATTTTCTTATCAATTTTGCCAGACATTAGAGCTCCTAAGATA
AAGGATAGATTCTTACATAAATTGAAACATATACCTGAGGGTTAAATTGACACAGATCCC
TCACTTATTTATGAGGAACCTTAGGAAGTCACACAAAGATTTGAAGATGAAGAGGATCTC
GTGGTTGAGCCAAAACTCCTTGAGTATATATTCCTAATTGATAGAAGTGGTTCTATGAGT
GGAAAGAGAATCAAACTAGCAGTTTAAGCTTTGCAATTGTTCTTGCACAGTCTTCCAATG
GGATGTAAATTCAACGTTGTTAGTTTCGGGTCAAACTATACCAAACTATTCGAAGAAAGT
TAAGAATATGACGATGAATCACTTGAAAGAGCCATAGAATAAATTGGAAAATTTGATGCA
AACATGGGAGGCACTGAACTCTTTCAGCCAGTCTAAGATATATTATCATAACCATGTGAT
CCAAATCTTCCAAGACATTTGTACTTGTTAACTGATGGAGAAATATGTGATACTCAAAAA
TTAATTGAGATGATTAGAGCAAACAGAGCTACAACCACTGTCCATAGTTTTGGAATTGGA
GATGGAGTAAGCTCTGAGTTAATTAAGAATTCAGCTTCAGCGGGATAAGGTCATTACTGT
TTCATAATGAACCCAGAAGAGATTGAGAGAAAAGTGCTTTAAGCTCTTCAAAAAGACTTC
TTGGAGTACATCATTGTGAAAGATATAAATATCCTTGACCAACATAAAAACATCATCGAG
CACCTCGTCACTGAAGACAATATTTCACATGGAGAGAAATTCAACATGATCAAGCTTCTA
CTTGATGAATCTAAGAACCCTAAATACGTAGAGATAACTTTCCTCGATCCAAACACAAGC
AAAGAAGTGACATAAGCTGTTCCTCTTAGATTAGCTTCAAGCGAGGCTTTAATTGCTTTA
GCTGGTCAAAGAGCCATCGTTGAATCAATTGATAGTAAAGGACCACTCTCCGTGAAATAT
CAAATTTTGCATTATACAACTGCAATGATTGCTTATGAAAAGATAATGGAAGATAACACA
CTTGAAATGCAATTGAGAAAAATACCTCTGATCTAAAGTAAAACAGAGGGTGGGGATTTA
GAATTATTCGTTAAAACCTTAACAGGCAAAACTATCACAATCTATACTAACTCAGATGAG
ACCATTGAAGAATTTAAGCTTAAAATTTAAGATAAAGAGGGCATTCCTCCTGACCAACAA
AGATTAATATTTGCAGGTATGTAATTAGAGGACGGAAGGACATTGGGAGACTACAATATT
TAAACAGAGTCAACACTCCATTTAGTTCTTAGACTCAGAGGTGGAGGCGGTATACTTATT
GTTTAAGATTAGGATACCAAATCTGAGGTAAAGATAGATGCTGACTTACACTAGCAAGTA
CTTCAAGTGAGAATGAAGATAGCTGAACAATGCAAATGTGACTTAACAAAGATTAAACTA
TTCTTTAAAGGAGTTGAAATATAAAACTCAAAGAATTTCAACAAGCTTAAGGATATTGGA
GTTGAATATGACTCTAAGGAATTAACTTACAGATACTTTACCTACAAGTCAATTGTGTTT
AGTTAGGGAGCTAATGGTTCATGGAATGATAAACTCTACAGACACATTAAGAATTAAGGA
TTTGCTGCATTAAAAGCCTTATAAACTGAAACCAAGATTTAGGCCTTAGAAGAACAAGCA
CTATTGACATTAGTAGGAATCAAAGTATTGACTGATAAATTCCCAGAGAATAAAAACGAA
TGGAAATTAGTTGCAGCTAAGGGTAAAAACTACCTCAAGAAATCTCTCTCAATTTCGGAA
GCAGAGGTGTAAGGCTATATTGATAAAGTCACATATGAGCTCATTTGA


>Contig13179.0.g39(protein)
METHSLKEILAQNSTNAMFLINKQSKHPIPLTKVDIFANVVQQLASFEMRQHYVNIEDIP
IETIYLFPVDVDSVFTNLEIEFTLQDGSKRQLITKVDLREKVQVKYEEAVASGKTAIVGS
FTKTQRDMVRVVIGNFPPNSSAVVKCFFHSKLDIEDISYCLRLPMSYVPRYMGDIQRYID
TGVMYKGQQPTQSQPLTEEQKSQNIQNIMEIVDQPMMDATSENAPYLWNLHLNIQMAGEI
QRISSRNHSIQIKNVSNSGFGSSAQVTLGDAVRNHVPNKDFILYLRDDTIGQPIAIKTKN
QYNENAIFLSILPDIRAPKIKDRFLHKLKHIPEGQIDTDPSLIYEEPQEVTQRFEDEEDL
VVEPKLLEYIFLIDRSGSMSGKRIKLAVQALQLFLHSLPMGCKFNVVSFGSNYTKLFEES
QEYDDESLERAIEQIGKFDANMGGTELFQPVQDILSQPCDPNLPRHLYLLTDGEICDTQK
LIEMIRANRATTTVHSFGIGDGVSSELIKNSASAGQGHYCFIMNPEEIERKVLQALQKDF
LEYIIVKDINILDQHKNIIEHLVTEDNISHGEKFNMIKLLLDESKNPKYVEITFLDPNTS
KEVTQAVPLRLASSEALIALAGQRAIVESIDSKGPLSVKYQILHYTTAMIAYEKIMEDNT
LEMQLRKIPLIQSKTEGGDLELFVKTLTGKTITIYTNSDETIEEFKLKIQDKEGIPPDQQ
RLIFAGMQLEDGRTLGDYNIQTESTLHLVLRLRGGGGILIVQDQDTKSEVKIDADLHQQV
LQVRMKIAEQCKCDLTKIKLFFKGVEIQNSKNFNKLKDIGVEYDSKELTYRYFTYKSIVF
SQGANGSWNDKLYRHIKNQGFAALKALQTETKIQALEEQALLTLVGIKVLTDKFPENKNE
WKLVAAKGKNYLKKSLSISEAEVQGYIDKVTYELI