Identifiers and Description

Gene Model Identifier

Contig1313.1.g99

Standard Name

None

Aliases

Contig1313_1_g99

Description

SF-assemblin/beta giardin

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006885602.000214949834694e-50hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1313.1.g99(coding)
ATGGCATCTGCTCACTAATTGAACCCACTCACTCAGAAAATGTCCTCGGCTTTCGCTTCC
AAGTACATCGACCGAGTGTCAAAGATCACAGAACGCCTCAATGATTTGCATCTGAACATC
GAACAGGAGAAATTCATGAAGCTAGAGAGCGTAGACTAGAAAATTGAATAGGTAGATGAG
AAAATATTGGACTGGCACGATACGAATAATAAGAAATTTGGGGTTTTCAGGGAACGCATT
AACGAATTTGTGAGATACATAGAAGAGGACAAGCAGGCCAAGGAGTACTCACATGAAAAC
AGACTCTAAGAACTCAAGAATTTAGAGGCAAAAATCTAGGAGAGATTTGAATAAGAGAAT
GCAGCACGCAGAGACATGGAGAAGAGGCTAGTGGCTATTGTTGAAGATAGATTTGCTGCT
CTCAAGCAAGATGTCTCCAAAGAGTCCAAGAACAGGTATGAGAGTGTAGAGCACTTGAAA
TCTTGTTTAGAAAATGACTTCCCAAAACTCTAAGAAGTTATCAAAGCCGAGTCTCTAGAG
CGAGAGGAGAACGATCTGCAAGTCAAGTAAAAAATCGAGGAGGAAGTCGAGAGACTTACT
GACATAGTTGGCAATGAAAAGAAAGCCAGAGAAGAAACTGAGGAGGCCATTTTGGAGATG
CTGAAGGACATGGTAAACAAAATCAAAGTGGAAATTGAAAATGAGAAAAAAGACAGAGAG
GAAAACGAAGAGACTTTGCTCTCTTTACTTGAAGATACTTGCAACAAACTTAACTCTACT
CAAGTTTAATGA


>Contig1313.1.g99(protein)
MASAHQLNPLTQKMSSAFASKYIDRVSKITERLNDLHLNIEQEKFMKLESVDQKIEQVDE
KILDWHDTNNKKFGVFRERINEFVRYIEEDKQAKEYSHENRLQELKNLEAKIQERFEQEN
AARRDMEKRLVAIVEDRFAALKQDVSKESKNRYESVEHLKSCLENDFPKLQEVIKAESLE
REENDLQVKQKIEEEVERLTDIVGNEKKAREETEEAILEMLKDMVNKIKVEIENEKKDRE
ENEETLLSLLEDTCNKLNSTQVQ