Identifiers and Description

Gene Model Identifier

Contig1313.1.g100

Standard Name

None

Aliases

Contig1313_1_g100

Description

Vacuolar (H+)-ATPase G subunit

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

  • vacuolar proton-transporting V-type ATPase complex (IEA) | GO:0016471
  • proton-transporting ATP synthase complex, coupling factor F(o) (IEA) | GO:0045263

Molecular Function

  • actin binding (IEA) | GO:0003779
  • proton transmembrane transporter activity (IEA) | GO:0015078
  • hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances (IEA) | GO:0016820

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000524609.997764199084386e-16V-type ATPase, G subunit famil
y protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1313.1.g100(coding)
ATGGAAGGAAGTGTCAAGAATCTGCTCGAAGCTGAGAAAGAATCACAAGCCATTATTGAG
CAAGCTGTTAAAGACAAATTAAAGAAGGTGACTGAAGCCAGACTTTACGCTGAGCAGGAG
CTGAACAAGCATCGCAAGGAGTACGAAGAGAGATACTTAGTCGAGGCTGCTAGAAAGACC
CAGGAAAATGCTGCACTCGCTGATTATGACATCAAGGCGCAGGAAGATATCAAATTAATA
AAATAGGATTTCGAGACCAACAAGAGACAAGTAATCAAGATGTTACTCGATCAAATCCTC
GTGGTAGACTTGAGTGTCCCCAAAGTCGTCAAGCAACAATTCGACTGA


>Contig1313.1.g100(protein)
MEGSVKNLLEAEKESQAIIEQAVKDKLKKVTEARLYAEQELNKHRKEYEERYLVEAARKT
QENAALADYDIKAQEDIKLIKQDFETNKRQVIKMLLDQILVVDLSVPKVVKQQFD