Identifiers and Description

Gene Model Identifier

Contig12864.0.g7

Standard Name

None

Aliases

Contig12864_0_g7

Description

hypothetical protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009416001.000137892321693e-31conserved hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12864.0.g7(coding)
ATGGCAATTGTTAAATGGCTTTCGCTATTCACTCTGATGCAATTAATGTTCCAAAATCAA
GTAGAAGCAGCTGTCTTTGTGAATATGGATATAGATATTGAACAAGGAGACTATATGGTA
AACTCACAGTGTGTGTATTCTTTTCAAATAATCACAGATAGGATTGACATTGGGACTGAT
ATCTAAATCAAGATACCTTATGATCTTTAGATGATAGCATCTGATGGCGCAGCTATAGGA
ATTTGCAAAGAATCTGCCTTCGTGTCTCTAACCAATTCTAGAACGAATAAGACTTTGACA
AATTGCATCTACAAGGAATATATTGGATACTCTGCTGTAACTTTAAAAGTAGGCGCTACC
TATACCGGCATCTCTGCTTACTACATCTATATTGGAATGATTAGGAATCCTCCTAGTGTG
AGATACACTGATTCTTTTGAAATTGCGTTGGCTAATGGATATCCAACTGGTTCATTCAAT
TAAGGATTGACATTGACCTATGTTCCTAATTTGATCTACAGTGCCACACTTACAAAGCTG
TACAATTAAGCAGGTACTACTGATACCTACACATTTAAATTCAAGGTTACAAATAACATC
CTTTAAAAAGGATTCTTGCAGGTTAAGTTCCCCAATTAATGGACATCTGCTCCCCAAACT
ATTCAATCAATTACAGCTATTAATGTCTATGGTACCACAAAATCAGGATTTGGTGTTGCA
ACTCCAATTTCCTAAACAGTTACTTATACAGGATTGTTCGATCTTGCTTAGTTAACAGCA
GACTCTACGAAGTTTATCACTGTTGTTATGACAGGAATTAAAAATCCTTCTTCTATTATG
ACTACTAATTCCTTCACCATCACTACTCTAGATGATGCCATGCAAGAAATTGATTAGATA
GAATCTGGACTTACAATTCAAATCACCTAGCCTGGTGTGATTTCTGTTGATGGCTTCACT
GTTTAAAGTAAAACAGTTGATGTATACACTCTCATTTAATTTACCATTACACCCTCAGTT
AAGTACTCTAATGGAGGTTATATTGAGGTTATTGGTGATACAAGTTATGTAACAGCATCT
ACAACTGTTTCATGTTCTGGTAGTTTGGGAATGTCAGGCACTACTACTTGCACTAGAGTA
AGTGCCTCTACTATTAGACTCACTAAGAACCCCTCTGCTGGACTTTTAGTTACCATATTC
CAAATGACTTTCAGTGTAGGTAATTTCAGAAATTCCCTGGGTGTTGTTACTCAGCCAGCA
TTCACGATTCAATTTAAAGAATCAGATGGAACTCTAGTTGCTCAGACCACTACTGCTGCT
TCTTATACAACTATCGCAGGGTCCATAACTTTGGTATCCGCTGTTAGAAGCACATCTGTC
CTAACTGTTGGATTAACAGGAGCATAATATACTTTGACTTTTACAACTTAAACCAGACTA
CCAACTGCAGGTAGAATCATTTTTACCTTTCCTGATGAACAGGTTGCATACTTTGCTAGC
ACAACTTGTTAAGATGGCACAGGAAAAGTCCTAACCTGTACTCTTGCTTAAGTGAGTGCA
ACATTTACTGTAACAATAGCTGCCAGCTAATATTGTTCAACTGAGTGTGCAGCAGGTTCC
TCTTTCACCTTAAAACTTATAAATGCCAAGAATCCAAGTTACATTAACAACCCCTTGAGT
TAATCAGTTCAGATAATAACTTAAAACTTTTTAAACAGTGCATATGTTGTTTTGGATCAA
ATTACTTCAGACATTTTTTTCACAAATAGTTTAGTTCCAGGCACATTGACTAGCATGGCG
CTAACTAGGACTGGATCTCAACTGACTGGTGGAGTGCCAATTTATACATTCACATTTTAA
ACTGCAACTATTTTGCCATCGGGTGCTGTTATTATAATAACATTCCCCACTGCAACGGGA
TATCTTTAAACTAGCACCAGTGTTACCTGTACAATTTCATCAGTATCTAAATCTTGCTCT
ACAACTAATGCTACTAGTGATAACAGCATACTTGAGACAGTCACAATAAGCAATAGTTGC
ACAACAAGTGGAGGTTGTGTTGCACCATTTTCATACACAATTGCATTGACAAATTTTTTC
AACCCATTTAGTACCATCGACAATACTGCTGTTGCATTCTCACTTTAGACAAAAGTTTCC
GTATCTAATGGCTTGGTAGATAGTGGAAGCTTTTCTGCCGCAAAATTAGCATTATCACCA
AATTCTTTGACAGTGGCTTTAGCAGCACCTACAACCCCAATTATAGTTGGAGACATAACT
TCTTATACACTTTCAATTACCATTCCTGTTAATAAGCTGCCTTCATTAGCAAATTAAGGA
TCTTTAGTCATTAATTTCCCAGCAGAGGCTGTGATATAGTCCTCTACTTGCACAGCTTAA
ACAACTTCTGCAACACTAAATTGTGCGGCGAGCACAACTACATAAGCAGTTACAGTAACT
AGTGCATCTGAGCTTCCTAAGAGTACTGTCATTACAATACAATTAGTGAATAATGTGAAA
AATCCACCTACAGGCGCCACATCTTCAACATTTGTATTCAACACATACTTTGGCAGTGCT
AAAATTGATACAAGCACCTCATTGACTGTCAAGCCTGATACCTTTAATGAGATCCTCAAT
CCACTTAGTGGTAGAGATGTTGTTACAATCAGTACTGCTTTCAAATTAACTCTATCTTTC
CAAACTACAAATCCTATACCTGCTAATGCTCAAATAAAGGTATATGTGCCAGTTGATCAA
GCTGTAATAGACACTTCTTAAACATTTTCTGCTACTGATAAATCAGGCACAGGTAGTGTT
TCGGTAGTTACTGCTCTTGCTGGTCCAACATCTAATTACAATACTTTTACTTTAAGAGAA
TGGTGTTCTGATGATAATAGTGGTTCATGTCCACCCACTTTTGCTTCTAAAGTTGAAATT
TCTGGTTTTAAAAATCCCCCAAATGCCCGTTTCCCTTCTAATTCAATTAAAATAGAAATT
TACACAAGTGCAGGTGACAAGATTGATGCTGTAACAACAAATTACTTCACTATCCCTTAG
TGTAATTACGGAGCAATGCAGAGTGTGACAATTAGTAGAACAGTGCATACTGTCGGATAA
AGCACTGCTTATACATTTAGGTTTTAGACAAATAGCAATGGCGATCTTGGTTCTCAAGGT
TATGTCAACATTTAATTCCCTATTGCTTATCTTTTTGACAAAACTTCACCAACACCTACT
TGCACTGTGAAAGATGCTACTTCTTCTGTCGCTGCTATTTCTACTACTTGCACGGCAACT
AAAGTGACTGATCCAAATAACATGGGTCAGTATGTTTCAATGATAGTAGGAGACTTGAAA
TGCTCAAGCATAAGTTGTGGAGGCAGTGCTACTTTTGAGTTCACTATTTCAGGTTATCTA
AATCCATTTAATACAAAACAAAGAGACGGCTAGATTATATCAACTTCAACAAGTACAGGT
TCAGGTGCAACAGCTGAAATCAAGAATGTTTTAGATTAAATTATCGGAACCGATATTTCA
AAGACTCAACTCCCTGATTTTACACCTGGTCTGCTTGTTGCTACTTCACTAATAAGAACT
GTTCTAAATGTGGATGCAAATACTATTATTCAATTTAGCTTAACTCTCCCAACCAGATTA
GAAAAGAATGGCTTTATTTATGTTTCAGTGCCTAGCTCATAATTTGTACCAAGCGGCGAT
AATTTCTAATACCAAATGTCATCTGGAACAACTACTTATGGCCTACCCTCAACTTTAACA
ATCTAATCTTAGACTTCAACTGAAACAATCTTCTTGATAAAAGAAACTTGTAGTGGTTCA
GGAAACTACTGTGCAGATAATTCAATTGTTAAATTCTAAATCTCAAAAGGTTTTGCAAAT
GTTGGATTTGTAACAACTCCAACAAATTTCTTCACCATTAGAACATATACAAGGGACAAT
TCTTATATTATTGATCAAGTTAAAGATAAATCAGCTACACCAGATGTCATTCCTGCAATT
ATTGTAGTCTCCTCTGTCACATTAACTAGTAACTATGCAACTTACACTGGGGTGACACTT
GACATTAACTTGAAATTCGGTGCAACAATAAAACCAGGCATTTATTTGCTGTTAACAATA
AGTGATGAATTTATCAGAATGGATCAAGGGGCATTAACTTGTTTCTTAGTACAATCATCA
GTAGAGACCGCAAAAACTTGTACTACAACACAAACATCAAATGTAGTAAACACTATTACC
ATTCCTAATCTTTGTACAACAAGTTGCGATGAAACAACAAGTTACACTATCAGAATTAAG
AATGTCGTTAACAGATTTTATGTAGCAGCTTTCACAGGCACAATGCTTATAGAAACCAGA
GTTAGCTCAGCATCATTGGTCAGTACTTTAAATTACTAACTCTCAAGTGTTGCTACTTTA
TTGCCAGGACCTTTAACAAACACTGTTGTGACCAGATCAAAAAGTACTTAGGGAGTAACT
GCCGACTACACTATAACATGGAAAACTCCTAGTTATCTAATTGATGATTCACTTGTTGAA
ATAAGATTTCCTCTCAATCAGATCATAATATCTTCTGGATCAGCGTTTACTTTTAAAAAT
GGTGTTAATAGTTTGACATTTAATACTGCAAGTGGAAGTCCAACCTCTACTTATAATATT
TTTGAAGCGACTGAATGGCTGTGTACTTCTCTTTGCACAACAGCAACTACATTTACTGTT
ACAGTATCCAACGCTAAAAACCCATTTATCTAATCAACAGATTATGATGATTTTATTATT
ATTCATAAAAGAACTGATGGGAAGCTAATATTATAATCTCCTATTAATCTAGATGCAACA
CCTGATTTAGCTTTTGGTGTAATTGATGGGATTACAATTACTCACTAAAACTACCCATAT
GTAGCAAGGAGCACAGAGTATGTGTTTGCGTTTACTGTAGAAGCAGATATCCCATAAAAT
GGTAAATTAAGATTCACATTCCCTCCAAATAGAGTGCTTTAACTCACAACATCAACTCTT
ACTTGCAATGTTGGCACCACGAGTTATCCATGTACTATAACCTATAATTAAGCAACTGGC
ACATAAGTAACAATATCAGGTCTTTGTGCAACTGGAGCTTGCACATCTCCCTTAACTTAT
TCAGTAACCCTCTCTGGAGCAATGAAGAACCCAGCTTCTGTACCATCCACTCAAACTGGA
AATTTTATCATTGAATCACTCTCCTCATCAAATATTATAGTGAGTCAAGGTAAAGTTGCT
CATGACACACTACCAAACATTCTACCTGAACCTATCGTAGTAAATATAACAAGAACTTCT
CCATATATGGGAGCAGATAACGATTATAGGATTCAATTTGAAACAGTAAATGCTATTCCA
GTCAATGGATATATTAGAATTGTATTTGCAAGAGATTAAGTAACTATAAGTGATAGCGTT
TAAAAGCCAGATTATTGTAAAATTGATTTTACATTAACAAAACTTAATTGCTAAATCTAA
TAAAAAAGTAGTAGCATCCTTGTTCTAGATATTAATTCACCCTGTGCGACAGGTTGTGCT
GCTGCTTATACTGTATAATTACTTTTCACTTCACTTAAAAACCCAGCTACCTTTTTGGCT
AACTCTGTTACAAGCAGTTTTTAAGTTTATACTATGAATGCTAATAAAGAGTATATTGAT
GGATAATATGAGAACTTGTAAGCATTGCCAGCTTTGATTGGCAAAACAGCTATTATTAAG
GCAGTGGAATTAGAAGATAATGTTGTAGCTCGTGCAAACTACCTAAGCTTCCTTGTGGTT
CCAGGCTCTGACTTCACAACCCTGGCAATATTTGATTTTTATCTCCCAGATTAATTTGCT
CTCTACAACAACCTGAATACTTGTTATGTCGTCATTGGATCAGATATTGGAATGAATTGT
ACTTTCACTTATTATACAAGTGGTTATATTAAGAAAGTGAGTCTCTCTAAGCCATGCCCT
TATGAATGTGATGAAACTGGAATATATCTCTTCAAAATACCCATTAAAAACAGAGGAGAT
AATTACTACACGGCAGGGTAGTTCATGGTGATTGAGAGATTTACTGATATTGATGTAGGT
TAAGGCACTATTCTTAACTCACTAACATTCGAACCAGACTTTATTGATGACTTTTATGTC
TACAACGATGGTAGAGACACCATTGAATAGGATAGCAGAGTATATGTGACTTTCAGACCT
GTAAACTTCTTGCCAACTAATTCCAATAGAGGAAGAATAAGAATAATTTTACCTGCAGAA
ATTACTGTTGACTCATCAAGTTGCCAAGCTAAGATTGATGAATCAAATTCAAGGATTGCT
TGTACAATTTCTGGCAAAACGGTCCTTCTCACTCATACTGCAAGCTCAGTTGTAAGCGCA
AATATAAGTGTTGAAGTCCCAAGAATATTTAATCCTAAGACCACTAGACCTACTAGTCCA
ATACTAATTTATACTGAAGTTGATTCCCTTAAAACTGGGACTTATTATACCATCGACAAG
AATATAATTAATGTAACTTATAAAGTAAATACTTGCACTACTCTGAATGATATTGAAATC
ACGAGATATCCTATGAACGATAACTTAGGATATTAAACTGGACAGCCTACATAACTTCTG
TTTAACTTATAGCTAAGACATGCTTTGGAATCAACCTCAAGTATTATAGTTCAAATGCCT
TTAGCTGCTTAAGCATAAATTAGTTCAACTACCTCCTCAGCTACATGCTATTCAACTGAC
TCAAAAGGAAACAATAAGAACCTATTGCTTTGTGAATTGCTAAGATCTAATAGAACAATT
ATTGTAAGAAATTATTGTCAAGTTGCGGCATGTGCTGTGAGAAGCAGAGTTTATTTCAAA
ATGTACGATGATTTCATTCTCAACTACAACTATGTTGTAAATCCATTGAATATTACTAGA
GACTCTATGCTAGTTAGGACAACAACCAAAGAAGGATACTATTATATAGATGAATCAAGT
ACTAATGTCTTTATTAAACCAGATCTTGTTCCAACTTATCTAATTCTTCCCAGTCCCGAA
ATTATCAGAACAAACAATGTTATTAATAGAAGAGTGTAATGGGTTACTAGTTTTAAAACA
AATAAAAATTTAGTACCATAGGGAGGTTACGTCTTGATAAACATCCCACAAAATGTACTT
CTTACAATTAAGAATTCAACCATAGATGTATTAAATTATGACACCTCAGTCATTTATCAA
AACTATACTTACGTTCTATACCCAGACGGTAAATCAGTCAAGCAAATAAACATGACTCAT
TTCTGTAATACTACTAAGGGATGCCCAATTGGTGCTGCTTATTCTTTAATGATTGATTGG
ATTAAGAATCCCATTTCACAATTAGGAAATATTTAAACTTCAATTACAATCGGTACTTTC
ACTAAAGAGGGCTATGCTGCTGAGGTAGGAACTACTCCTTTTGTTGTCCAGCTTTTCTCT
GAGCTTATTCCTGTTAACTTACAAAATCTATTTATAAGAATTCTCAACCCAGTACCTTCA
GCAATAACTGATTATACATTCACCTTTTCAGCTGATGCAGAATTTAACAAAACAAACATT
TTATTGATTACTTTCCCAGCAGAGATAAATCCAAACCCAACAGTCATAACTAGTAGGATG
CTTTAAACAAAGAAAAAGTGTGAAGCTCCACTGACAACATTTGCAAATCTAACTTGCACA
ATAGTTAATAATACTGTCACAGTAAAGGGACTATTCTTGGATGGTTACTAATAATACAGC
ATCAGAGTCAATGGAGTAATGAATCCTCTAGTTGCTGGAACAACTTCAGGATTTACTCTA
GAAGTTTAAAACTCTAATAGTCTCACAATTGCTAGTAGATCAACAAACACCAGAATCAAT
ATAGTGGATGAAATCAAGGACTAAAGTACATGCAATAAAGTTTGTGGATCTTGTGCAGGT
ACTACTTCAACCTGTACTTCTTGCAAAAACCCATCTAAATATCCACTTTTCAGAAATTAT
GCATGTGTTGACGAATGTGGAGATGGATACTTCTTTGATGAAATTAATTTGCAATGTGCT
TAATGTCATCATGGATGCTCTGATTGCACAGGTGCAGGAAGCAATAAATGTCTTAAATGT
GCAAGCAATTATTATTTAGAAGATGGAATATGTGTACCATACTGCACTAAAGGTATGATT
GAAGATTCTACACTTAGATAATGCAGAAAATCAAACTCTACTCTCTGTAGTGCTAATTGT
AAAACTTGTTCACTTTCATCAAATTATTGCTTATCCTGCAAAGACGATTCAATCTATGCA
TATTTGGATATGGCAAGTGGAAGATGCATTCCAGATGATACCACCTAATGCAATAGCACA
TAAAGTGCAAGATTTTACATCGATAAAACTGAAAGAAAATGTAAAGTCTGCAATGAGCTT
TGTAAAACTTGTGAGAGAGGTCCTAACGTTTGTTCTTCATGCTGGTCCTTCTAATTAAAT
GATAAGATAAATGAACTTTACGAAACATGTGTAGATGTTTGTGGCTTAGGAACTTGGTAC
AATAAACCCAATAATATGTGCTCATACTGTAATCAAGTTTGCTTGACTTGTTCAGGTTAT
GAGTCAGATTAATGCTTAGTTTGTAATAAAACACCAGAAGCTAGATAATTATATCTAAAT
GACAATGAATGCGTTCTATAATGCCCTAAGAGATATTACATTAATGAAATTAACAATGAA
TGTGTGGAGGGACAAGCGCAAATTCTTTCATTCTCATTCTTGTTCATGTTTGCTTCAGTT
TTTGCAGGACTGTTAGTTATAGTAATTTCAATGTGGAGAACAAAAAACAAACAAAAAACA
ATTGATGTAATATATGCAGTAATCAGTTGCATTGAAGCATTAAATAGACTTTTCTTGCTT
GGTAACATGTGGTTTAAGTCTAATGTGTTTGCACTTGCAGTCTGCTTTATGAATCTGATA
GCTACTTGTGCAATTGCAGTTTTCTTCAATTTCTTGTTTATGTCTCCAATCTATGCTCAC
TCACCCCATTTCAGAACACTCTACAAGAAATTCAGAATGGCATATAACACAGTAACTTGT
GTGAGTTATTTTGCTGGTGCTAATTTAATGAGACTCCTCTGTTCAAACTTCCTAGGTTTG
GAATCATTGCAATCAGACTTAAACAATTGGAAATTCTTTATTGTTCCTTTAAATACAATG
ACAAACTTTACAGTTATCTTTTCAGTATGTTAACTAGGTATTGATGTTTTCATTCTAATG
ACACTAACGATAAGTGATGATGCCTTCGTATTGGCTATTCTGGGCTTATTCATTAATGTA
ACAATGATAACTTTCCAAATATTTAAACATCTTAACGTTAAAGCTTACTTGATAAGGAAT
TCATGA


>Contig12864.0.g7(protein)
MAIVKWLSLFTLMQLMFQNQVEAAVFVNMDIDIEQGDYMVNSQCVYSFQIITDRIDIGTD
IQIKIPYDLQMIASDGAAIGICKESAFVSLTNSRTNKTLTNCIYKEYIGYSAVTLKVGAT
YTGISAYYIYIGMIRNPPSVRYTDSFEIALANGYPTGSFNQGLTLTYVPNLIYSATLTKL
YNQAGTTDTYTFKFKVTNNILQKGFLQVKFPNQWTSAPQTIQSITAINVYGTTKSGFGVA
TPISQTVTYTGLFDLAQLTADSTKFITVVMTGIKNPSSIMTTNSFTITTLDDAMQEIDQI
ESGLTIQITQPGVISVDGFTVQSKTVDVYTLIQFTITPSVKYSNGGYIEVIGDTSYVTAS
TTVSCSGSLGMSGTTTCTRVSASTIRLTKNPSAGLLVTIFQMTFSVGNFRNSLGVVTQPA
FTIQFKESDGTLVAQTTTAASYTTIAGSITLVSAVRSTSVLTVGLTGAQYTLTFTTQTRL
PTAGRIIFTFPDEQVAYFASTTCQDGTGKVLTCTLAQVSATFTVTIAASQYCSTECAAGS
SFTLKLINAKNPSYINNPLSQSVQIITQNFLNSAYVVLDQITSDIFFTNSLVPGTLTSMA
LTRTGSQLTGGVPIYTFTFQTATILPSGAVIIITFPTATGYLQTSTSVTCTISSVSKSCS
TTNATSDNSILETVTISNSCTTSGGCVAPFSYTIALTNFFNPFSTIDNTAVAFSLQTKVS
VSNGLVDSGSFSAAKLALSPNSLTVALAAPTTPIIVGDITSYTLSITIPVNKLPSLANQG
SLVINFPAEAVIQSSTCTAQTTSATLNCAASTTTQAVTVTSASELPKSTVITIQLVNNVK
NPPTGATSSTFVFNTYFGSAKIDTSTSLTVKPDTFNEILNPLSGRDVVTISTAFKLTLSF
QTTNPIPANAQIKVYVPVDQAVIDTSQTFSATDKSGTGSVSVVTALAGPTSNYNTFTLRE
WCSDDNSGSCPPTFASKVEISGFKNPPNARFPSNSIKIEIYTSAGDKIDAVTTNYFTIPQ
CNYGAMQSVTISRTVHTVGQSTAYTFRFQTNSNGDLGSQGYVNIQFPIAYLFDKTSPTPT
CTVKDATSSVAAISTTCTATKVTDPNNMGQYVSMIVGDLKCSSISCGGSATFEFTISGYL
NPFNTKQRDGQIISTSTSTGSGATAEIKNVLDQIIGTDISKTQLPDFTPGLLVATSLIRT
VLNVDANTIIQFSLTLPTRLEKNGFIYVSVPSSQFVPSGDNFQYQMSSGTTTYGLPSTLT
IQSQTSTETIFLIKETCSGSGNYCADNSIVKFQISKGFANVGFVTTPTNFFTIRTYTRDN
SYIIDQVKDKSATPDVIPAIIVVSSVTLTSNYATYTGVTLDINLKFGATIKPGIYLLLTI
SDEFIRMDQGALTCFLVQSSVETAKTCTTTQTSNVVNTITIPNLCTTSCDETTSYTIRIK
NVVNRFYVAAFTGTMLIETRVSSASLVSTLNYQLSSVATLLPGPLTNTVVTRSKSTQGVT
ADYTITWKTPSYLIDDSLVEIRFPLNQIIISSGSAFTFKNGVNSLTFNTASGSPTSTYNI
FEATEWLCTSLCTTATTFTVTVSNAKNPFIQSTDYDDFIIIHKRTDGKLILQSPINLDAT
PDLAFGVIDGITITHQNYPYVARSTEYVFAFTVEADIPQNGKLRFTFPPNRVLQLTTSTL
TCNVGTTSYPCTITYNQATGTQVTISGLCATGACTSPLTYSVTLSGAMKNPASVPSTQTG
NFIIESLSSSNIIVSQGKVAHDTLPNILPEPIVVNITRTSPYMGADNDYRIQFETVNAIP
VNGYIRIVFARDQVTISDSVQKPDYCKIDFTLTKLNCQIQQKSSSILVLDINSPCATGCA
AAYTVQLLFTSLKNPATFLANSVTSSFQVYTMNANKEYIDGQYENLQALPALIGKTAIIK
AVELEDNVVARANYLSFLVVPGSDFTTLAIFDFYLPDQFALYNNLNTCYVVIGSDIGMNC
TFTYYTSGYIKKVSLSKPCPYECDETGIYLFKIPIKNRGDNYYTAGQFMVIERFTDIDVG
QGTILNSLTFEPDFIDDFYVYNDGRDTIEQDSRVYVTFRPVNFLPTNSNRGRIRIILPAE
ITVDSSSCQAKIDESNSRIACTISGKTVLLTHTASSVVSANISVEVPRIFNPKTTRPTSP
ILIYTEVDSLKTGTYYTIDKNIINVTYKVNTCTTLNDIEITRYPMNDNLGYQTGQPTQLL
FNLQLRHALESTSSIIVQMPLAAQAQISSTTSSATCYSTDSKGNNKNLLLCELLRSNRTI
IVRNYCQVAACAVRSRVYFKMYDDFILNYNYVVNPLNITRDSMLVRTTTKEGYYYIDESS
TNVFIKPDLVPTYLILPSPEIIRTNNVINRRVQWVTSFKTNKNLVPQGGYVLINIPQNVL
LTIKNSTIDVLNYDTSVIYQNYTYVLYPDGKSVKQINMTHFCNTTKGCPIGAAYSLMIDW
IKNPISQLGNIQTSITIGTFTKEGYAAEVGTTPFVVQLFSELIPVNLQNLFIRILNPVPS
AITDYTFTFSADAEFNKTNILLITFPAEINPNPTVITSRMLQTKKKCEAPLTTFANLTCT
IVNNTVTVKGLFLDGYQQYSIRVNGVMNPLVAGTTSGFTLEVQNSNSLTIASRSTNTRIN
IVDEIKDQSTCNKVCGSCAGTTSTCTSCKNPSKYPLFRNYACVDECGDGYFFDEINLQCA
QCHHGCSDCTGAGSNKCLKCASNYYLEDGICVPYCTKGMIEDSTLRQCRKSNSTLCSANC
KTCSLSSNYCLSCKDDSIYAYLDMASGRCIPDDTTQCNSTQSARFYIDKTERKCKVCNEL
CKTCERGPNVCSSCWSFQLNDKINELYETCVDVCGLGTWYNKPNNMCSYCNQVCLTCSGY
ESDQCLVCNKTPEARQLYLNDNECVLQCPKRYYINEINNECVEGQAQILSFSFLFMFASV
FAGLLVIVISMWRTKNKQKTIDVIYAVISCIEALNRLFLLGNMWFKSNVFALAVCFMNLI
ATCAIAVFFNFLFMSPIYAHSPHFRTLYKKFRMAYNTVTCVSYFAGANLMRLLCSNFLGL
ESLQSDLNNWKFFIVPLNTMTNFTVIFSVCQLGIDVFILMTLTISDDAFVLAILGLFINV
TMITFQIFKHLNVKAYLIRNS