Identifiers and Description

Gene Model Identifier

Contig12856.0.g88

Standard Name

None

Aliases

Contig12856_0_g88

Description

Spc97 / Spc98 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005229900.000000000000005001692698841201Spc97 / Spc98 family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12856.0.g88(coding)
ATGTATCAAATTTAGAGAATAGCTGAAGAATTCATCATGTCAAACATATATGCACATACC
TTTCCAGACACCAATGATACAGAGATAAAAAGATCTTTAAAGAATCTAAATGTGAAATTC
GAAATACAGAATTAGAGTGACAAAGTGGAAAGATTAAATTATCTGATGGAGTAATTCATG
AAGCGCAAACTAAAAAACACGGGTGGCGGCTATGGACAAGTCCACTACTCAGTTATCAGA
CTGCTTTTATTGCTTTAAAAATCTCCCACTAACATTGAAAATCTAGACGATGTTAAAAAT
GCAGCATCAATGAGAAATAAAGTATACCGCACAAGAGAAGAAATTTAACAAATGGAAGAT
AATAATATAACTGAGCTCCTTAAGATAAAAACAGAGGAAGACTAAGTCATAGATAAAATT
AAGGAAGACTGGGAACTCGAGTGCATGAGTGCTAGCAGCTGTGGCAGCAGTCAAAGTGAC
GATGAAGATTTAAGTGATAATGATTAGAAAAATCATAAATAAGGTCAAACATACAATAAG
AATGACAAATAATAGAATAATAACGAATAAGAGATCGATTAGCATGAGTTTTAATTTGGT
TCAAAACTCAAAAAAGGGCTAGAATATAGAAAAGTGGAGAAGGGTAATATAGAAAATACT
CAAGCATATTTTGGTGGTATGCCCATTGGGAAAATTAGAGCTCCGATTATTAAAACTGTG
TAAATCTAATCAAATACTTCAAAGAAAATTAAGAAATTCTCCATGAACGCCTTCTTGGAT
AAATATTTGGCTGAAATCTAGCCAACTCCAAATCCATACTATGAATACATAAAAAATAAG
GAAGCAGATGAACTTGAGTATGAAATACAGAAACAGCAAAAACTCAAGAGTATTTTAAAT
GTGAGAACTTTCGATTAACTTTAGAATTAATTGTCTCGGAGAGTTGATAACGAGGATTTA
ACTAGGAATCAAAACAAAGCTTAAGATTCTTTAGAAAATTCACACATGTCCTCATATAAT
GAACCCTTGAATTTAATGAGAGATTTCAATCAATCTAACCAAGAAAAACTAGGCTTTTTG
CAATATAACACAGTTACTGAGAGGCAAATCGTCTTAGATACTATTCTTATGATGCAGCAA
TTTGAGACACCTACATATTACAAGAGTAAATAGTAAAATGGAAGAAAGCAAATATTTAAA
TTGAGGTAGAAAATATAGTTGAAGCATTTGACACCCATCATGCTAGAGGGTATTCTTGGA
GAGTTTATTTAAATGGCTAATATCACTAAGGAAACATTGGAATTTCAGAGATCATTAAAG
GAAAATTAAGCCTTTTTAGGAATGGTATTTGAGAGTTTTGTCTTTTAAGTTGATCTTATT
CTTCAAAAGTTCAGCTCAGAAATGTCTGACATTTAACAAATCGCTCTCTTACAAGCAGGA
TAAATATCTAAATAGTAGCTAACTTTGAACTCTATTTCACTGTCTTTAGTTAAAAACTTT
GTTACAATTGATGAACCGCTTACTCTGTTAAGATTAAAGCAACTTATAAATGCTCATGTA
TTCAAGAAGATTTAACTTTTACATGATATTATGAGAAATGGAATTATGGATTTCTTGATA
TTGGAAGATGAAGATTTGCTCAGACTTCATGACTTCAGTGAAAATAGCGTTGCTAATCTT
GACGATTCATCAAATACTTAAATAAACATAAACCAGTAAAATCCTTCTCCCCTCCCTTAA
GTCTTAGTAGATAAAATAAAAGCTGCAGATAGAGTGACATTTCTCTTAAATTATTTATTC
GTAGTAATCAAGAATAATCAACTCTTAGACCACCCAGAACTAAATCTTCTTAAAGAAATT
TTCATTGCTTCAGCCTAGCCTTACATCGATATAATGGCAGATTGGATAGATAAGGGCTAA
TTGAAGGACCCAAAGCAGGAATTTTATATCAAAGCAAACCCAAAAATCTTCGAAAATAAC
AATCAAGGAAGTGATAATACTCCTTAGACTGGCAATAACCAAAACCGTTAAGGTCAAGCT
TAGGATTAAAATAAGAATGCTTCTTCTTAGAGTCAATGGCAAGACAGCTATATATTTAGA
ACTATTAATCTCAAGGAGCTTCTTGGACAGGGGAATCAGGGTTTCAGTCCATTTTTACAA
GCAGCAGAGCATTAAAAAGTAGAGGTTTCCATCCCTATTTTCTTAAGACCATTAATGAAA
GAAATCCTGTCAATCGGTAAATCAATTAAAATTGTAAGATACCTGGATAAACTGCACATT
GTTAAAAGTGGCTTCCAGGAATTCGTGGACTTTAAATCTATATACTAAGAGAAATTGATT
AAGGAAATTGATATGTTTAAAGTTAAGGAAGATTAGTTCTCATACTATGATGAAGAAAAA
TTCCAGCCAAATGAAAAGCTTATATAGTGTGGATAGAATAATCTTAATAACTACTGGTAG
CCTACAGTGAAGATTGGAAATATAATGAATGAATCAACTTAGATTAAGAATTATAGGGAA
CTGCTGAATATTGCACCATTCTAATGGTCTACTAATGAAGAAGGTACACCTGCTCTTAAC
AGCAGTGGTCTGAACATTTTCCAGTTACCACATATATAACGAGGCCTAGACAACAGTTTC
GCATCCACTCACCATTCAGATACCCAATTCACACCTGAAAAGCTAGAGAATCCTAATCAA
ATAAACAGGCACTCGCATTAGAATTTGTTACAATTGGAGGATGTAGAAATGAAGTCAATA
AGTGCAGATTTAAACGATAAATTCAACGAGTCAAATGAGAATGGTATTTTCAAGAAAAGT
CTACTGGACAACGATAAATACATGAAGCTCTCCAGTCTTTATAATTATTCACACGCTGAG
TTAATTAATTACCAGGATTCTATGTAAAACTATCAAGCATATCAAACTTTTGACTATCTA
ACAAAAAACACACAAGACACTGAAAATCAAAAGAAAGAAGAAAATTTAACTTCAAATAAG
ACTTACTCTTTTAAACATCAAACTATAGAGAATTTTGTGAAGCAGACTCTCATTTCTCCA
CTGCATTAGATCTATATAAGAACATGTTCTCGTTTCTTCAAAAGTTTAAACACTCAATGT
AGGTTTTAAGAAACCCTCAAACTACTTAGACAAGTATATTTTATGGAAGCTGGCCATCAA
ATGCATTAATTCGGTCTCTCTTTGTTTAAGCAGATGGATAAGGGAAGAACCATTGATAAT
TTATACATGGTCAATGGCTAATTTAGAGAAAGTGTCAGTCATAACAGTTTTCTACACAAA
GACGCAGAGTTTTTGGAGAAAATAAGAGTGGTTTTTAAAGAAGATCCTAGATAGTATGCT
ATCAATTCAGTTACTGGACTTGACTACTTGAGTTTTCAATACCAAAGCGACTGGCCTCTT
GAGATCATTCTAGATAAACAAACGATAAACTACTACAACTAAATACTAATACATCTTTTA
AGATTGAAAAGAGTAAATTACGTGCTATCTCTCAAAGATTACTGGCTTAGACCCACTTAA
AAGCTGCCTAAATAGTATGACTAAATGAACATAAAGGAGCAAATTATGCATAAAAACAGA
GTGATGCTGGATAAACTGCTTCATTAGTTGTAAATCACTTAGAAAGAATTCTTGCACTTC
TCTAACAATTTGGAGTACTACTTGAAAACAAGAGCAATCTAATAAATCTGTAATGAACTT
GATACAAAACTGAAAGACCTCCAACATGACTACACCTCTAACGAAGAATTCCAAAGTAAC
AACGTGTCTGCAGATCAAATCGACCCCAATTCAATGATAGACATGGATGCCCTGATTTAG
ATTCATCAAGAATTCCTCATGAACATCATGAGACTATGTCTGCTAGACTTAAAGAGCAAG
ATTTTACTTGATTTGGTGCTGAAAGTATTGCAAATATGCTTGAATTTCAGGGAATTGTGC
TTGAAATACCTGATTAGAAGTGAGGGATAGTCTGGGCAATTTAAAGATAGCAAAATGCCC
AATTATAACAACGACGGGGATAGTAGTGATTTGAGTGATGACCTGGGACTCAACAATTTG
TCAAGAGACGAGGACGAGGATGAATACAGTGGATCGAATAGAGACAAAGAAGCTTACTAT
CAACAATATGGAAGAGGATTGCTAAGAGTAGACAGCATTAAATTTATGGATAGAATAGAG
GAATGCCAAGTTGAGCTTAACGAATTGAGGAGCAAATTCTAGACATACATGCAGATTCTT
ATTGAAAATCTAAAGAAATATACAAAGAAAGGAGTCTTCTCATATTTAGACGAGGCATTT
ATCAGGTTTAACTTTAATAATTATTATATAAGTAGAGATAGAGAGGGATTAGACTCAGAT
GAAAATCGTGTTTGA


>Contig12856.0.g88(protein)
MYQIQRIAEEFIMSNIYAHTFPDTNDTEIKRSLKNLNVKFEIQNQSDKVERLNYLMEQFM
KRKLKNTGGGYGQVHYSVIRLLLLLQKSPTNIENLDDVKNAASMRNKVYRTREEIQQMED
NNITELLKIKTEEDQVIDKIKEDWELECMSASSCGSSQSDDEDLSDNDQKNHKQGQTYNK
NDKQQNNNEQEIDQHEFQFGSKLKKGLEYRKVEKGNIENTQAYFGGMPIGKIRAPIIKTV
QIQSNTSKKIKKFSMNAFLDKYLAEIQPTPNPYYEYIKNKEADELEYEIQKQQKLKSILN
VRTFDQLQNQLSRRVDNEDLTRNQNKAQDSLENSHMSSYNEPLNLMRDFNQSNQEKLGFL
QYNTVTERQIVLDTILMMQQFETPTYYKSKQQNGRKQIFKLRQKIQLKHLTPIMLEGILG
EFIQMANITKETLEFQRSLKENQAFLGMVFESFVFQVDLILQKFSSEMSDIQQIALLQAG
QISKQQLTLNSISLSLVKNFVTIDEPLTLLRLKQLINAHVFKKIQLLHDIMRNGIMDFLI
LEDEDLLRLHDFSENSVANLDDSSNTQININQQNPSPLPQVLVDKIKAADRVTFLLNYLF
VVIKNNQLLDHPELNLLKEIFIASAQPYIDIMADWIDKGQLKDPKQEFYIKANPKIFENN
NQGSDNTPQTGNNQNRQGQAQDQNKNASSQSQWQDSYIFRTINLKELLGQGNQGFSPFLQ
AAEHQKVEVSIPIFLRPLMKEILSIGKSIKIVRYLDKLHIVKSGFQEFVDFKSIYQEKLI
KEIDMFKVKEDQFSYYDEEKFQPNEKLIQCGQNNLNNYWQPTVKIGNIMNESTQIKNYRE
LLNIAPFQWSTNEEGTPALNSSGLNIFQLPHIQRGLDNSFASTHHSDTQFTPEKLENPNQ
INRHSHQNLLQLEDVEMKSISADLNDKFNESNENGIFKKSLLDNDKYMKLSSLYNYSHAE
LINYQDSMQNYQAYQTFDYLTKNTQDTENQKKEENLTSNKTYSFKHQTIENFVKQTLISP
LHQIYIRTCSRFFKSLNTQCRFQETLKLLRQVYFMEAGHQMHQFGLSLFKQMDKGRTIDN
LYMVNGQFRESVSHNSFLHKDAEFLEKIRVVFKEDPRQYAINSVTGLDYLSFQYQSDWPL
EIILDKQTINYYNQILIHLLRLKRVNYVLSLKDYWLRPTQKLPKQYDQMNIKEQIMHKNR
VMLDKLLHQLQITQKEFLHFSNNLEYYLKTRAIQQICNELDTKLKDLQHDYTSNEEFQSN
NVSADQIDPNSMIDMDALIQIHQEFLMNIMRLCLLDLKSKILLDLVLKVLQICLNFRELC
LKYLIRSEGQSGQFKDSKMPNYNNDGDSSDLSDDLGLNNLSRDEDEDEYSGSNRDKEAYY
QQYGRGLLRVDSIKFMDRIEECQVELNELRSKFQTYMQILIENLKKYTKKGVFSYLDEAF
IRFNFNNYYISRDREGLDSDENRV