Identifiers and Description

Gene Model Identifier

Contig12845.0.g80

Standard Name

None

Aliases

Contig12845_0_g80

Description

V-ATPase subunit C

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam03223 ) V-ATPase subunit C
  • ( pfam02403 ) Seryl-tRNA synthetase N-terminal domain
  • ( pfam10112 ) 5-bromo-4-chloroindolyl phosphate hydrolysis protein
  • ( pfam12506 ) Protein of unknown function (DUF3713)
  • ( pfam05739 ) SNARE domain
  • ( pfam06103 ) Bacterial protein of unknown function (DUF948)
  • ( pfam01920 ) Prefoldin subunit
  • ( pfam06156 ) Protein of unknown function (DUF972)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001053204.0017993270483566e-44Vacuolar ATP synthase subunit
C
SGDYKL080W2.000130478826482e-26VMA5 SGDID:S000001563, Chr XI
from 285030-286208, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12845.0.g80(coding)
ATGGTTTTCAATGTGGTAGCTTGCTTTATTCAGGGCAAGGAGGAGAGCGAACTCGAGAGA
TACTTAGCACAGTCACTCGGATCAGGCAGCAAGGCTCTTGCTGAGGTATTCACTGTTCAG
TTGGAAAAGTCAAGATTCAAGGTTGGTACTCTAGACTCTTTGATGGAGTTGAACGAAACT
TTGCAAAAAGTAGACCAGACCCTAGACTCCACCGTCAAGAAGATTGAAAAGTAAGCAAAG
GAGATGGTTGGCAGAGACCTTAAAATCGAAGTAACCAAGCAATAACAAGTTGATGTTTAC
GATTACATCAAGAACTTCAACTGGGACGACAACAAGTTCCACAGAGGCAGATCCCTCGTT
GAAATCGCTGGTCTCATCTCAGAGAAAATGAGAACTATTGATAATGATATCAAGACCTTG
AATGATAATATGAATGAGACCAAGAACGAGCTCAACTAACTCGTGAAGAAGGATGGAACC
ACTCTCGTGACCAAGGACATCTCAGACGTTATTCACTCTGACCCCAACATCAAGGCCGAG
CAGATGTTCGTTGAAGTTCACAAGACTCAATTCCTCAGCACTGTCATTGCTATTGTTCAC
AAATCCAAGATCGATCAATTCGCTTAATAATACGAGAGATTAGTGAGAGATCAGCAAATT
CCACCAATTGTTCCACAAAGCTTGAAATATCTAGGTATTGAAGACAAGGAGGGAAATCAA
CTCTACAGATTTGTGTGCTTGAGTGCATAACTCGATAACGTGATGAACAGAGGCAGACAA
GAAGGCTTCTCTTTCAGAAAATTCACCTATGACTACGCAAAGTATCAAGAAGACTTGAAA
CAAAAGACTGTGCTTGAGACCTCATTCGAGCAAATGAAGCACTAATTGGCATCAAGATGC
TTCTACGCCTTCTCAGAGCTGTTCATTGCTCTTATGCATTTGAAGGTCATGCGCGCTTTC
ATCGATGGTGTCTTGCGTTTCGGTATCCCTCCCAGATTCTACATTGGTATCCTCAGGCCA
GTGAAGGGCGCTGAGAAGCAAGTGTTGCAAAGATTAAGCGAGACTTTCGCTGATGAGACA
ATGAAGGACATGTACGGCTCAAAGGAGGACACCCAAGACACCGAGGACTTCTTCCCATTC
GTAAACATCCCACTCACTTCCCCTCTCTTCCTTCAGTGA


>Contig12845.0.g80(protein)
MVFNVVACFIQGKEESELERYLAQSLGSGSKALAEVFTVQLEKSRFKVGTLDSLMELNET
LQKVDQTLDSTVKKIEKQAKEMVGRDLKIEVTKQQQVDVYDYIKNFNWDDNKFHRGRSLV
EIAGLISEKMRTIDNDIKTLNDNMNETKNELNQLVKKDGTTLVTKDISDVIHSDPNIKAE
QMFVEVHKTQFLSTVIAIVHKSKIDQFAQQYERLVRDQQIPPIVPQSLKYLGIEDKEGNQ
LYRFVCLSAQLDNVMNRGRQEGFSFRKFTYDYAKYQEDLKQKTVLETSFEQMKHQLASRC
FYAFSELFIALMHLKVMRAFIDGVLRFGIPPRFYIGILRPVKGAEKQVLQRLSETFADET
MKDMYGSKEDTQDTEDFFPFVNIPLTSPLFLQ