Identifiers and Description

Gene Model Identifier

Contig12832.0.g49

Standard Name

None

Aliases

Contig12832_0_g49

Description

Cyclin, N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004259702.9989272749380808e-50Cyclin, N-terminal domain cont
aining protein
SGDYDL155W2.9995979253168707e-35CLB3 SGDID:S000002314, Chr IV
from 176773-178056, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12832.0.g49(coding)
ATGAACTCTGCTCAAAATAGCCAAATCACAACTGGTCATCTCAGTTAAGCTCATCACTCA
GGCATCTCTCAAATGACTGACTAACTCAAGGGACTATCTCTTGCAGGCTAATCTGTATCC
TACTCATCAGTCCCTGCTAGTTAGATCACTGCTGGAAATAAAGAAAACAATAAAAAGACT
CCTAACGACACAATCACTAATGCAAGCGGACCCAAAATGACTCTCAAGGCTAGAGAGTTT
GGACGCGAGATTACTAATGCTACAAGTTAATCTACTAACAGTGGATCACTTTCCAGCAAG
TAAACTCATTAGACCAGTCAGATTGTTTTGGATAATGCATATTAACCTAATATCGGTGTT
TCAGGGTAAAACATATCATTGATTAGCGGAGTTAATGGCAGCTTCTCTTCTCACGCTACT
GCTCAAACCAAGAGAAATGATCCAAACGCCTATCCTGCAAGACTTACCGCCAACTCAAGA
TTCAGCTCACAGAGAAACGTTAATCTGCCTTCAGGTTAAGTGTAATAACAGAAATCGTCA
ATCAACACTAGTATTCTCGCTCAGAATAATTTGCTAAAAAAGGCTAAGACCAACGTATCA
GTTCCCCACGTGAACAACAATCAATCAACAGTCGAGTCTTCAGTGGAGTCAAACTCCGGC
CCTTCATCTCAATCAAAATCTGATAAGAGTGAGAAAGAGGACTCCTTAATCAAGCTCTAA
GTCATCCCAGTCTTAGGTGCTATAACTACAGTGCCAGAGACTGCTGAGCAAGTTAAGGAA
AAGTGCAGACAGAGAATTGACGATTACAAAAAAGCAATCAAGAAGAATATGCCACTCAGT
GATTAACTTGACATGAGAGATCCACAGTGCATTGCTGAGTTTGCTCAAGAGGTTTATTAA
TCCATGCTTGACAAGGAACCAGAGTACTACATTGACCACGAATATCTGAAGAAGGTACAG
AGTGAAGTCAAGGATACTTCAAGAGGATTTTTAGTTGAATGGATTATCGATGTTCATAGA
AAATTCAGACTTATGAGTGAGACTTTGTATGTAACAATCAGCATCATTGACAGATATCTA
TCGAAGGTTGCTATCAAGAAATCACAGCTACATCTTCTAGGAGTCACTGCTCTACTGATA
GCAACAAAGTATGAAGAGATCTACCCACCAGATCTTAAGGATCTTTTGAGTGTATCAGAG
AACAAATTCTCAAAGGAGGAGGTTCTCAAGATGGAGTACATCATCATTTAAACCCTTGAG
TTCAACTTTTTCGCTCCCTCAGCTTTGAGATTTTTGGAAAGATTTAGAAAGATATCAAAC
ACTGCATCAGATGACTAAATCTTCTACTTCGCCCAGTACTTAGCTGAGATCGCTCTTCTG
GACGCCTTCCTCTTGAAACACAAGCAATCCCACCTAGCGGCCGCTGCTTTCATTTTGAGT
GCCAAGAGCATTAAGAAGATTAATGCTTGGAACAACGAGATGGAGAAAGTTACAGGCATC
AAGGAGAAAGACGTCAAGGAAGCTGTTGATGATCTCAAGCAATTCGCTCTAGAAGTGAAC
CCTAAGTTCCTCTCTACATTGAAATACAAATTCTAGAAAAATGAGTACTTAAATGTTGCC
CAGATTCCTTTTGCTTTTTGA


>Contig12832.0.g49(protein)
MNSAQNSQITTGHLSQAHHSGISQMTDQLKGLSLAGQSVSYSSVPASQITAGNKENNKKT
PNDTITNASGPKMTLKAREFGREITNATSQSTNSGSLSSKQTHQTSQIVLDNAYQPNIGV
SGQNISLISGVNGSFSSHATAQTKRNDPNAYPARLTANSRFSSQRNVNLPSGQVQQQKSS
INTSILAQNNLLKKAKTNVSVPHVNNNQSTVESSVESNSGPSSQSKSDKSEKEDSLIKLQ
VIPVLGAITTVPETAEQVKEKCRQRIDDYKKAIKKNMPLSDQLDMRDPQCIAEFAQEVYQ
SMLDKEPEYYIDHEYLKKVQSEVKDTSRGFLVEWIIDVHRKFRLMSETLYVTISIIDRYL
SKVAIKKSQLHLLGVTALLIATKYEEIYPPDLKDLLSVSENKFSKEEVLKMEYIIIQTLE
FNFFAPSALRFLERFRKISNTASDDQIFYFAQYLAEIALLDAFLLKHKQSHLAAAAFILS
AKSIKKINAWNNEMEKVTGIKEKDVKEAVDDLKQFALEVNPKFLSTLKYKFQKNEYLNVA
QIPFAF