Identifiers and Description

Gene Model Identifier

Contig12816.0.g91

Standard Name

None

Aliases

Contig12816_0_g91

Description

Glutathione S-transferase, N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam02798 ) Glutathione S-transferase, N-terminal domain
  • ( pfam00043 ) Glutathione S-transferase, C-terminal domain
  • ( pfam13417 ) Glutathione S-transferase, N-terminal domain
  • ( pfam13410 ) Glutathione S-transferase, C-terminal domain
  • ( pfam13409 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006616602.998577119979921e-31Glutathione S-transferase, N-t
erminal domain ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12816.0.g91(coding)
ATGGATATTTCAAAACCAACACTCGGATACTGGAAGATAAGAGGATTAGCTTAACAGATT
AGATATATTTTTGAATTCTTGAAAGTTCCATACGATGAAGTGCTGTATGAAGTTGGGGAT
GCTCCAGATTATAGCAAAGACGCTTGGAATAGCGTCAAGCAAAAACTTGGATTTGACTTC
CCTAATCTACCATACTTGATAGATGGAGACCTTAGAATAACTGAGAGCCAAGCCATTTTG
AGATATGTTGTGAATAAGTACGGCAAGGAACTTCTGGGTAAGACCCCAGAAGACTAAGCA
TTAGCGGACTAACTCTATCTTATTCTTACTGACATCAACTATTCTTTGGAAGGTATGAAA
AAAGTCAATGATTACATGACTGGAAAAACTTATGCTGTTGGTGATTACATAACCTATGTA
GACTTCCAATTCCTAGAAACTTTAGAATTTGTAAGTTGGATCACAGAAGAAGATGTCTTT
TGCATATTCCCAAAGTTGCAAGAATACTATAACAGAATGCGCGATATTCCTTAGATCAAG
GAATACATGCAGTCGGAGAAGTTTATCATGCTTAAATTTAATAATGGTCATGCGAAGATC
AATACCAATCCTTCAATTGTCAAAGCAACCTACTGA


>Contig12816.0.g91(protein)
MDISKPTLGYWKIRGLAQQIRYIFEFLKVPYDEVLYEVGDAPDYSKDAWNSVKQKLGFDF
PNLPYLIDGDLRITESQAILRYVVNKYGKELLGKTPEDQALADQLYLILTDINYSLEGMK
KVNDYMTGKTYAVGDYITYVDFQFLETLEFVSWITEEDVFCIFPKLQEYYNRMRDIPQIK
EYMQSEKFIMLKFNNGHAKINTNPSIVKATY