Identifiers and Description

Gene Model Identifier

Contig12765.0.g65

Standard Name

None

Aliases

Contig12765_0_g65

Description

Probable N6-adenine methyltransferase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam10237 ) Probable N6-adenine methyltransferase
  • ( pfam03602 ) Conserved hypothetical protein 95

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007735001.9999167998962255e-60hypothetical protein
SGDYGR001C0.00000000000001000191320216021YGR001C SGDID:S000003233, Chr
VII from 497365-497133,49...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12765.0.g65(coding)
ATGGAAAACTTAAACCCATTCTTGGCAAAGAACAAAGAAAACGCAGATCTCAATTAATAT
TGGTATTCCAAGCCAACTATTAACTTCCTGGCAAGTGAATGTGAGCAATTCGGTAAAAAG
ATAGCGTTTTTATCAACTCCCAGTGTGTATTTTTCACTTAAGAATAAGGAAATTAAAGCT
AACTCTAAGTGTTTTGATTATGATGAGAAGTTTGGAAAAGACCCTAATTTTATCTTTTAC
GATTTTAACAAGCCAGAGGATATTCCAAGAGAATTAGAGAAGCAATTTGATATGGTTGTA
ATCGATCCACCTTTCATCACAAGAGAAGTTTGGGAGAAGTATACAGAAGCATCGAAATTC
TTGCTTGCTGACGACGGAAAAATATTGCTCAGCACAATTGATGAAAACGAAGCATTTATT
TTGGAGTTATTGGGAGCTAAAAGAAGACAGTTTAGACCATCAATTCCTAACTTAGTTTAC
TAATACAGTTTATATTCAAATTACGACAGTGAAGGATTAAATAATAAGAACCCTGAGATT
CCAGAGTTTGATTGA


>Contig12765.0.g65(protein)
MENLNPFLAKNKENADLNQYWYSKPTINFLASECEQFGKKIAFLSTPSVYFSLKNKEIKA
NSKCFDYDEKFGKDPNFIFYDFNKPEDIPRELEKQFDMVVIDPPFITREVWEKYTEASKF
LLADDGKILLSTIDENEAFILELLGAKRRQFRPSIPNLVYQYSLYSNYDSEGLNNKNPEI
PEFD