Identifiers and Description

Gene Model Identifier

Contig12667.0.g30

Standard Name

TRM3

Aliases

Contig12667_0_g30

Description

SpoU rRNA Methylase family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002182802.999564368270328e-76RNA methyltransferase, TrmH fa
mily protein
SGDYDL112W4.999350823993609e-33TRM3 SGDID:S000002270, Chr IV
from 258915-263225, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12667.0.g30(coding)
ATGAGCAATACCACAGAAATTTAATTACAGCAAATTTTACAGAGATTTAACACTCTTTAT
TCCAAGTTGTCCCGCAGAGATACTGGTGACATCACACTTTTAGATAGGATTAAACTTTGC
AAGTCACTTGCTAAGAGTGAGGCATCTACCATCCCTAATAGCATGTTGCTTTTCGAGCAT
ATTGGAAATATGATTAATGAAGTGAAGCCTCTTGAACAGATCAAAATTAATGATTAGGAT
CTTTTCCTCATATTCCTGTCCACAAACATCCAAGTATAATTCTCATCAGTCCCAGCTGAG
TCATTGGTGAAGTTCTTGTTCGAAATCTTAGGAAAGGCATAAGAATATATTAGAAATAGA
AAGAGTGAAAATGACACAGACACTGCAAATGATATTTCCTTAAAGAATGATGATGCACTT
TAAAGTTTGATTGAAATGAACAACTAAGTACTCGTTTAAGTGATAAAATGTGGAGAATAG
GCTTAGTTGCTTTTCCTATCAGGAGTGATAAACCAGTTAGAGACCTACTTGAAATAAACC
CAAGGTCAAATCTTGAATTTGCAAGAGTTCGCTCCAATCTCGATTGTTTACAAGCTAGTT
GAGTACTTAATCAAGAATAAGAGATTTACCTTTACTGAGTCAGTTCTTAAACAATTAGAT
CACTTACTTTAGATTACATTTTAATTGTTTGAGATTTACAAGCAGAGTTCACAATTCTTT
ATCATTAACATTGCTAGTTCCAGCAAATAAGAAGAGGAGAGACAAGTCAGAAGAATGTCT
GTTTTGTTTACTGACATTTTAGAGCTTTTCGTTTAGTTCAGTTGTTTATACTTGAAATCC
CTTGCAAAATTAGGCCTCACTTAGTTATATGTGGGTCACTCTATGAGACTTTATTAAACC
CTCTTCTCAGACTAAGAACAAGCTGTTCTGGTCTAAATTCAAACAAGTCAGCAGATATTA
GACCAACAAAACCAAAAAGATGATCAACCCCAATAAAATGTGAATTTAGAGTACTTCACT
CTAAGAGAAAGACTTAAGATTTTGAATGAGCTGAACTCAATATTTAATTTGATTCCTGAG
ATAGTAACAAAGAAATACTATTGGAAACTTATATAAGAAGGGCTATATGATACAGACAAC
TACTGCAGAAAGGTTAGTATTGGTGTGATGAAGAACAATTTGCTCGTTATTGGAAGGGAA
AGTTTATATGAAGGATTCTTGAGTAAAGACGAGTTTGAGACACTTTGGAGTACTTTCTTT
GATATTTATGATACTCTTGAAAGTTTTGGATCACATTTGACAAAAGCTGTATGGGATAGA
ACAGAGGTGATGTATAGTTACATCAGAGATAAATACTCTCAGGGCTTTTAGCCTCATCCA
CTTCTAGATTTCAGAGAGTGGCTTTTCGTTCTGTATAAGAGAATCTAAACTCATCCCAAC
TTAAAAGTGAGAAGATACATCATCAAAGCTACTCTTAAGAGAAAGTATGTGACTGTGCAC
ATGAATGAATACATTTTTGACATTTTCTTGAAGTCCCTGAACAAAGGACTTATTTTCAAG
GATACTAACATATACACTTAATTCTCACTAGCCAATGAGTTGGTTAATAAGTTTTATGAG
CAGTACTTCTTCAATGAGAGCATTGATATTGCTGGTGATTTGAGAGATTTCTTCACTGGT
ATTGTTAAACATGTGTCCTACCCATAATTGATTCTATGTTCCCTTAAGATTATCTCTAGA
GAATATAAATAGAATGATGGTTTTATTGGGAATGAAGAACTTAAGTAGATCCAAGAACTC
ATGAACTCCTACTTTGCAGAGTAAATCTTCAGCAGCAAGTACTTATGTTACAAGTATATC
CACATGATGCTGGCTTAATACCTAAACAAGAACGAATTCAAGACACTTAATTACAGTCTT
TTGTTTAAGATTATTGGTAAATTCCCAATTCAGTTCTTCACTAAAGAGGCTTCATATTAA
GACGAAGAGGCTCATAAATTCACATAACTTTTTACTTTTCAGTTTGGTAGTCAACTTGCA
GTCGATAGAACTATTGATTCGTATATTAAAGATTTATTTGAAATTAAGGCAATAGTAGCA
TAAATGCCTAAATATGGAACAGATATTGAGCTTATTATTCAGGGGTTAGCTAGAGTTCTA
TTGGGTCTTGGAATGTAGTATCAAGATTAATAATACCAGATAATTGCTAATATTCTCAGA
TCTTCTTTAGAAACTTTTAACTAATTGATGGGTAGTTCTTACTTGAGTCCAGAAGTACTA
GATTCCAAAGTTAAATACATGAGCATACTATTCAAAACAATCTATAACTTTGGTGATGAT
AGATTTAAACACTACTTAAGGATAGAAATTATTCCCCACATTCCTGTTATACTAGATAGA
TTTGAAAATAATTTGATTTTACCTCTTAGTAAATATGAGCAAATTCAATTTTAACCAAGT
GAAAGACAAAAAATTCAATCACTATTCCAATTTCTTGATTACTACCTTGATTTCATTCAA
GTCGCAATCTAAATGACTCATATAAACCAAAACTAATCCAACTCAGCTCTTGAGAAATTT
ATCAAGCATATTTTCCACATGACACTCAGGATATCTTCGGCCAAAGAGCTATAAACTCTT
AATGGCTGGGGTCCATTCCTTTTGCAGTATGTTTTATATAACTGTGTGAAGAAGATCACT
CACAAGTATGTTAAAGGCATCAGAGATTGCCTAAGAAAAGGAATCTAATATTTCTTAGTA
CCTGAAGATATCTTCCAGATCGGAGTTCCACTCATGCATAACATCTTGGAGTTTAATTAA
GTTCCTCGACCAAAAGATGATGATAGTGAAGAATTCAACGAGGCTAGAAAGTTTATGATT
GACAATAACACCTCACTTACAACCATGGCTTAATAGACTTTACTCTGCTAATGGAAAACC
TTAAGTGAATTAGTGCAGATATTCCAGTATGAAGCTTCAATCAAAGCAGAAATTACTAAG
TTCTATCCAGTAATTGCAGAGAAAGCCTCAGATTTCTTATAATGCACCACTCCTCTATAT
TTAACAAGCATTTACAGAGTTCTGAAGTTGACCTTCATTCCATTATTGAAATAAAAGATT
TTAGCTGGTGAGGAGTAATAAGAGCATAGTATCATTCAATATTAACAAATCAGCTACTAA
ATGTGGGTACTTGTAAAAGAATTGAAAACAGAATTTACAATTTCATGTTTACAGCAATTT
ATTGAATTCACTTTTGACCCTGAAATCATTGAACTTTATCATAGAAATCTCTAGGGTCAA
GTAAGCGATTAAGTTAAGAACTTCCATAACAAAATGGCAAAGGAAATATTTGACCAAGGA
AACAAATACTGGTTAATATTCAGATCATGCTTTAATCATTTGATGTTGTTATTCTGCAAT
AAACCATATTTAATGAAAGGATTTGAGCAATTTGTCATGAACTTTGCAATCTGTAGGGAG
GTTAGAAGCTTAGATGCTGAGATTAACCTATATTAATTAAAGAATCTGATTCCATAGATA
ATAACCAAGGATTATGAAAATTTGCCAATGGAAGAAATTACTTATCAAGGTGCTTATATA
AGAACTTTGACTATGATCATCTTGGAAGAACTCTTAAGAAGCCACAAAATACATCTGATG
AGTGGAGCTTAATTAAACCAAAATCATGTTGATTTCATTGATGCAATGGAAAACTTAATC
ATTAAACTGCTCGATCTTAACTTCGTGAAAGCTTACATTCATGCTGACATGCCCTACTCA
GAGAAACATAGAGTTAAAGTTAGAGCTTGGTAAACCATAATCGTCTTGATGGAATTCTTA
GATCCCTCACTTTATACAACATAATTCAGGTAGATGAGAGTTTAACAGTCAGGCATTGAT
ATAATTTAAGAATTTAATGAGAGATTCTGGAAAGTAGTTGGAATGAATCATTTATCCTCC
GTAAGGCAATTCTTAGAAATTGTTGCTATTAAGTTCACTAAGATGTACCCAGAACTCTCC
ATCCAGAATCCACTATTTATTAAGACACTACTTGATCCAAACATCAAAGCTCAAGTGGCC
TCTTCCTTCCTTGTTATCGCTGGCTATATTTTAACTCAACCACTTAATGTAGCAAATGAA
ATTTAATTAAAACGCACTATTTTTGAGTAGTTAGCTGGTTTCTTGACATCTAATTCAGCT
CATGCTAGATGTGTGGCTCAATATTTCATTTATGAATTGCAGTCCAATCCTAATTAAGCC
TACAGAGCATTTATCCCAGAAGGTATGATGCCCCTAGTAAACTTCCTTATCAACAACAGA
GATGTTAAGAAATTAATGAGCAAGGAGGAAGTTGAAATCAAAAGAATTGAGTAAGTTGTT
GAGAATCTAAAGGGAGTCTAAATAGTATTATCTACCCAGATAGATTTCAATGGTGAATTC
CTTAGCACAACTTTCGTTGAGAGAATCAGAGATGTCTTGAGTGATGGAATCAGTGAAATT
AGAAGGCAAGATCAACAGCCCATTGATAGGGAAGATTTGTGGAAAATGGAATTATAAATC
AGAAAATAGAATGGATAATTCTAACCAATATTAAATGAGGAGAGTAGCTAGAATTACTAG
AGAAAGATTTTACCTTGGGAGAACTTTGAGTTGGACTATGAGTCTCTAAAGAAGAATTTC
GACAACAGAAAGAGAAACGAAATCATAATGTGTGCTGCTCTTATTGATAAGGTACCCAAC
TTAGCAGGTTTAGCAAGAACCTCAGAGATCATGAATGCCTCATGTTTAGTCATTAACAAT
AAAAACGTGTGTGATTTAGACGAATTCAAGGGTGTTTCAGTGACATCAGAGAAGTGGCTC
CCAATCGTTGAAGTCAAGGAGAAAGATCTTTATGAATATCTTGAATTCCAAAAGACAAAT
GGATATGTCATTTTAGGTTTGGAGTAGACAGCTGACAGCAAAATGCTTCATGAATATAAA
TTCCCAAGCAAGTGCATCCTACTATTGGGCAAAGAGAAGGAAGGTATTCCACAGAAGTAT
TTGAACGTGTTAGATCACTGCATTGAAATTCCTTAATTTGGAATCATTAGAAGTCTTAAT
GTGCATGTCAGTGGAGCACTATGTTTGTGGGAATACACTAAGCAACATATTCCAAAGAAG
CTTAGTCCTCAATGA


>Contig12667.0.g30(protein)
MSNTTEIQLQQILQRFNTLYSKLSRRDTGDITLLDRIKLCKSLAKSEASTIPNSMLLFEH
IGNMINEVKPLEQIKINDQDLFLIFLSTNIQVQFSSVPAESLVKFLFEILGKAQEYIRNR
KSENDTDTANDISLKNDDALQSLIEMNNQVLVQVIKCGEQAQLLFLSGVINQLETYLKQT
QGQILNLQEFAPISIVYKLVEYLIKNKRFTFTESVLKQLDHLLQITFQLFEIYKQSSQFF
IINIASSSKQEEERQVRRMSVLFTDILELFVQFSCLYLKSLAKLGLTQLYVGHSMRLYQT
LFSDQEQAVLVQIQTSQQILDQQNQKDDQPQQNVNLEYFTLRERLKILNELNSIFNLIPE
IVTKKYYWKLIQEGLYDTDNYCRKVSIGVMKNNLLVIGRESLYEGFLSKDEFETLWSTFF
DIYDTLESFGSHLTKAVWDRTEVMYSYIRDKYSQGFQPHPLLDFREWLFVLYKRIQTHPN
LKVRRYIIKATLKRKYVTVHMNEYIFDIFLKSLNKGLIFKDTNIYTQFSLANELVNKFYE
QYFFNESIDIAGDLRDFFTGIVKHVSYPQLILCSLKIISREYKQNDGFIGNEELKQIQEL
MNSYFAEQIFSSKYLCYKYIHMMLAQYLNKNEFKTLNYSLLFKIIGKFPIQFFTKEASYQ
DEEAHKFTQLFTFQFGSQLAVDRTIDSYIKDLFEIKAIVAQMPKYGTDIELIIQGLARVL
LGLGMQYQDQQYQIIANILRSSLETFNQLMGSSYLSPEVLDSKVKYMSILFKTIYNFGDD
RFKHYLRIEIIPHIPVILDRFENNLILPLSKYEQIQFQPSERQKIQSLFQFLDYYLDFIQ
VAIQMTHINQNQSNSALEKFIKHIFHMTLRISSAKELQTLNGWGPFLLQYVLYNCVKKIT
HKYVKGIRDCLRKGIQYFLVPEDIFQIGVPLMHNILEFNQVPRPKDDDSEEFNEARKFMI
DNNTSLTTMAQQTLLCQWKTLSELVQIFQYEASIKAEITKFYPVIAEKASDFLQCTTPLY
LTSIYRVLKLTFIPLLKQKILAGEEQQEHSIIQYQQISYQMWVLVKELKTEFTISCLQQF
IEFTFDPEIIELYHRNLQGQVSDQVKNFHNKMAKEIFDQGNKYWLIFRSCFNHLMLLFCN
KPYLMKGFEQFVMNFAICREVRSLDAEINLYQLKNLIPQIITKDYENLPMEEITYQGAYI
RTLTMIILEELLRSHKIHLMSGAQLNQNHVDFIDAMENLIIKLLDLNFVKAYIHADMPYS
EKHRVKVRAWQTIIVLMEFLDPSLYTTQFRQMRVQQSGIDIIQEFNERFWKVVGMNHLSS
VRQFLEIVAIKFTKMYPELSIQNPLFIKTLLDPNIKAQVASSFLVIAGYILTQPLNVANE
IQLKRTIFEQLAGFLTSNSAHARCVAQYFIYELQSNPNQAYRAFIPEGMMPLVNFLINNR
DVKKLMSKEEVEIKRIEQVVENLKGVQIVLSTQIDFNGEFLSTTFVERIRDVLSDGISEI
RRQDQQPIDREDLWKMELQIRKQNGQFQPILNEESSQNYQRKILPWENFELDYESLKKNF
DNRKRNEIIMCAALIDKVPNLAGLARTSEIMNASCLVINNKNVCDLDEFKGVSVTSEKWL
PIVEVKEKDLYEYLEFQKTNGYVILGLEQTADSKMLHEYKFPSKCILLLGKEKEGIPQKY
LNVLDHCIEIPQFGIIRSLNVHVSGALCLWEYTKQHIPKKLSPQ