Identifiers and Description

Gene Model Identifier

Contig12645.0.g31

Standard Name

None

Aliases

Contig12645_0_g31

Description

Ras family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009415406.99980278126514e-75Ras-related protein Rab11A, pu
tative
SGDYER031C6.997420649987812e-71YPT31 SGDID:S000000833, Chr V
from 214747-214076, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12645.0.g31(coding)
ATGGAATCATTCGATAACTCAAATTTTTACGACTACTTATTCAAGATAGTACTGGTTGGG
GATTCTGGAGTTGGTAAATCTAATTTACTGATGCGCTTTGTTAAAAATGAATTTCACTAA
AACATGCAGACTACTATTGGCGTTGAATTTTCCACAAAGTCTATGTAAATTGAAGGTCAA
TTGGTCAAAGCTTAAATATGGGATACAGCTGGTCAGGAAAGATATAGGGCATTAACCCAT
GCCTACTATAGAAACGCAGTTGGGGCCTTGCTGATCTATGACATCACTGATAGGCAGAGT
TTCGAGAACCTTAAAAAATGGTAAAGTGAGCTAGCTAATCATTCTGAAGCCAATACAGTC
ATGATCTTGGTGGGCAATAAGTGTGATTTAAGCGATCAGAGAGCTATTAAGATTGAAGAG
GCTGAGAAATTTGCTCAATCAAATAATATGGCGTTTATAGAAACCAGTGCTCTGAATGCT
AAAAATGTGAATATAGCCTTCAAGAATTTAATAACAGAAATTTTCAAGATATCTCAGGTG
GGAAAATTCAATTAATAAGTCAAGGAATTAGATGTTACATCTTTTAATAATACTCAAACT
ACTGGTGCACTCTCAAAGCCAACAACTCATCAAACATCACATAAGGGAGCAGGCTCAAAT
AACATATCAAAAAGTATAATATTAACTTCAAACGATCACAAAATGAAGTCCTCAATTGTG
GAATCAAACCGTAATAATAAGAAAAATGGCAAAAGCACTTGCTGCTGA


>Contig12645.0.g31(protein)
MESFDNSNFYDYLFKIVLVGDSGVGKSNLLMRFVKNEFHQNMQTTIGVEFSTKSMQIEGQ
LVKAQIWDTAGQERYRALTHAYYRNAVGALLIYDITDRQSFENLKKWQSELANHSEANTV
MILVGNKCDLSDQRAIKIEEAEKFAQSNNMAFIETSALNAKNVNIAFKNLITEIFKISQV
GKFNQQVKELDVTSFNNTQTTGALSKPTTHQTSHKGAGSNNISKSIILTSNDHKMKSSIV
ESNRNNKKNGKSTCC