Identifiers and Description

Gene Model Identifier

Contig12595.0.g15

Standard Name

None

Aliases

Contig12595_0_g15

Description

Cyclic nucleotide-binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

  • cAMP-dependent protein kinase regulator activity (IEA) | GO:0008603

Biological Process

Domains

  • ( pfam00027 ) Cyclic nucleotide-binding domain
  • ( pfam02197 ) Regulatory subunit of type II PKA R-subunit
  • ( pfam11712 ) Endoplasmic reticulum-based factor for assembly of V-ATPase

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002051807.997392158323398e-113cyclic nucleotide-binding doma
in containing p...
SGDYIL033C1.999385218781115e-51BCY1 SGDID:S000001295, Chr IX
from 291669-290419, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12595.0.g15(coding)
ATGGAAAGCACTGACTAATCAAGAGAGAATCAACTTTATTTGGAAAAGAACAACGAACTT
GCTCAACTTTTGGAGACATTCTCCGTACAAATCAGAAATAAGAAACCCAAGAATATCCCA
TAATTCTTAATGGGTTACTTGATTCAAACTTATGGAGATAGAGCAACAGTTGCTGATAGA
TACATAGGAGAGCAATATAAGAGTGAGCTCGCTAAACTCGAACAGCTTGTAGAGCAGAAA
AAGCTTCAAACATCGCTTGCAAGCGCCCAAAAGACTAACGACACTGATGTTGGATCAGAA
AATGAAACTGACGAAGATGATGACGATGATTACATTGATGTTTTGCCAGAGCAAATTAAA
AAAGCAGCAGGTAAAGGTCCAAGATCTTCAGTGAGTGCTGAAGCTTTTGGAGCTTGGAAT
AAAAAGAGTGACTTTAGCGCCAGACATGTTGAAAAGTCTGACGACACCAAAGACGCTATT
AGAAGCAGACTGAGCCAATCATTCTTATTCAATTCTCTCAATGAGGAAGAGTTTAAGATA
GTCGTTGACGCTATGGACTAGAGAAGAATCTAACCAGGTGACAATGTTATTGTTTAAGGG
GAAGATGGGTACGAGTTGTTTGTAGTTGAGCAAGGTACCTTGTCATGCTATAGATAATTC
GCAAATTAATCATAGGCTACCTTCCTAAAGAAGTACGAAGCTGGTGATGCCTTCGGAGAG
CTTGCACTACTATACAACGCTCCAAGAGCTGCCACTATTACTGCAGATACCGAAAGTTTA
TTGTGGGTGCTCGATAGAGAGACCTTCAATCATATTGTCAAGGACTCATCTAGAAACAGA
AGAGAGAAATACGAATCTTTCTTAGCCAAGGTTAAAATCTTGGAAAGTATGGAACCTTAT
GAAAGGTCAGTTCTATCTGATGCTTTCGTTGAGGAAACTTTCAAGGCAGGAGAATACATC
ATCAGAACAGGGGATGAGGGCAACAAGTTCTACCTGGTTGAGTCAGGTGAATTATTCGCT
ACTAAAGTTTTAGACAATCATGAGGAAGCTAAAGAGGTCATGCAATATAAAGCTGGAGAT
TACTTCGGTGAAAGAGCTCTTATCTAAAATGAGCCAAGAGCAGCTAATGTCATTGCTAAA
ACTGATTGCAAGTTAGTAAGTATGGATAGACACAGCTTTAAGAGACTTATGGGTCCCCTC
GATACAATTCTCAGAAGAAATATGGAAGTTTACGAAGCTTACAAAGGCATTGACTCTAAG
AAAGGAAAACTATGA


>Contig12595.0.g15(protein)
MESTDQSRENQLYLEKNNELAQLLETFSVQIRNKKPKNIPQFLMGYLIQTYGDRATVADR
YIGEQYKSELAKLEQLVEQKKLQTSLASAQKTNDTDVGSENETDEDDDDDYIDVLPEQIK
KAAGKGPRSSVSAEAFGAWNKKSDFSARHVEKSDDTKDAIRSRLSQSFLFNSLNEEEFKI
VVDAMDQRRIQPGDNVIVQGEDGYELFVVEQGTLSCYRQFANQSQATFLKKYEAGDAFGE
LALLYNAPRAATITADTESLLWVLDRETFNHIVKDSSRNRREKYESFLAKVKILESMEPY
ERSVLSDAFVEETFKAGEYIIRTGDEGNKFYLVESGELFATKVLDNHEEAKEVMQYKAGD
YFGERALIQNEPRAANVIAKTDCKLVSMDRHSFKRLMGPLDTILRRNMEVYEAYKGIDSK
KGKL