Identifiers and Description

Gene Model Identifier

Contig1238.1.g128

Standard Name

None

Aliases

Contig1238_1_g128

Description

Regulator of chromosome condensation (RCC1) repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam00415 ) Regulator of chromosome condensation (RCC1) repeat
  • ( pfam13540 ) Regulator of chromosome condensation (RCC1) repeat

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005318604.997860539111522e-53regulator of chromosome conden
sation protein
SGDYGL097W0.000000009996807949091551SRM1 SGDID:S000003065, Chr VII
from 321782-323230, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1238.1.g128(coding)
ATGAATTCTCTAATTTATTAAGCACGCAAAAGTTTCGGTACATCAGTCTATCTCTGGACC
TCTATGCCTCGTCTTGGGCCAAAGGCAACTGAGATTAAGCAATAAATTTAAATACCAAAG
GGTATACCATAGAAAATGGAGGCATTCGATAAACTTAATGTTAAGAAATTGAATATTGGA
CTTAGACACTCAGCTGTTATTACAGAGGATGGAAAATTGTACACTTTTGGAAGTGGTAAC
TGGGGTCCATTAGGACATGGTTCAGAAAAAGATGTAAAGTTTGACAATCCCTAACTCGTT
GAGTTCTTTGAAAAGAGAAACAAGAAAATAGTAGAAGTTGGTTTAGGAGAGTATCACACA
GCAGCCCTTACTTCAGATGGAGAAGTTTATACTTGGGGATATGGTGGAAAGCAGACTCTT
TTCAATTGGATGATCACTTAAGAAGTTGGAGGTCTTGGGCATGGGGATAAGAAGCATCAT
TTCTTCCCAAAGAAAGTTGATTTCTTTGAGAAAAACAATATCAAGGTATCCAGGATTCTT
GCAGGTCTCTATCACACAATTGCTATTTCAGATACAGGTGATTTATACACCTGGGGCAGA
GGCCTTTTCGGAGTGTTGGGAAATGCTAGTAATTCCTATAGTCTCACTCCCATGCTAAAT
GATGAATTTCACATTATGAAATAAGAAAAACCTGATCTTAAGATTTAAAAAATTGATGTT
GCTGATGAATATACTGGAGCTTTAATGAACGATGGCACTCTTTATGTGTGGGGTAAGAAC
GATAGAGGTCAACTCGGTACTGGCTCAGGCATTGGAATCGATATGATCGAATCAGAAAAC
GTGCCAATTGCTATCACAGTGCTTGATAAAAACGATCAACCACACTTAGTAAAAGACTTC
CATCCAGGTCAAAATACCATGATAATTAGAGACGACGAAGACAATATTTACAAGGTAGGT
TTGAAGCTAGACTACTCCCCTAAGCAAGTTAATATCTTTAATGAAGAGTTCAAGAAGGAG
GACGTGACTCAATTGAGTTGTGGTCGTAAGCACTATTGTGTACTTAACAATCAAAATAAA
CTTATGGTCTGGGGCAACATCTTCAAGGAAAAGCCAGCAGCTGAGGCTGATGGATTTGGG
CTACATTATGGTGATCAGCTATTCGATGGAGGCAAAATCAAGGAACTTTCACTTAAATAC
AGCATCTTTGGAGCACTTGTAGAACACAAATGA


>Contig1238.1.g128(protein)
MNSLIYQARKSFGTSVYLWTSMPRLGPKATEIKQQIQIPKGIPQKMEAFDKLNVKKLNIG
LRHSAVITEDGKLYTFGSGNWGPLGHGSEKDVKFDNPQLVEFFEKRNKKIVEVGLGEYHT
AALTSDGEVYTWGYGGKQTLFNWMITQEVGGLGHGDKKHHFFPKKVDFFEKNNIKVSRIL
AGLYHTIAISDTGDLYTWGRGLFGVLGNASNSYSLTPMLNDEFHIMKQEKPDLKIQKIDV
ADEYTGALMNDGTLYVWGKNDRGQLGTGSGIGIDMIESENVPIAITVLDKNDQPHLVKDF
HPGQNTMIIRDDEDNIYKVGLKLDYSPKQVNIFNEEFKKEDVTQLSCGRKHYCVLNNQNK
LMVWGNIFKEKPAAEADGFGLHYGDQLFDGGKIKELSLKYSIFGALVEHK