Identifiers and Description

Gene Model Identifier

Contig12351.0.g55

Standard Name

None

Aliases

Contig12351_0_g55

Description

S25 ribosomal protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam03297 ) S25 ribosomal protein
  • ( pfam10154 ) Uncharacterized conserved protein (DUF2362)
  • ( pfam01978 ) Sugar-specific transcriptional regulator TrmB
  • ( pfam06278 ) Protein of unknown function (DUF1032)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYLR333C0.0000000010002658722841845RPS25B SGDID:S000004325, Chr X
II from 795899-795573, Ge...
T. thermophilaTTHERM_006862200.00000005999527666938375hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12351.0.g55(coding)
ATGGGCCCAAAGTAACAAAAGGGAAAAGACGCTAAAGGCGGCAAGGGAGACAAGGGCGGT
AAGTCCTCAGCTTCAGCTGTAAACAAGAAAGCCGGTGGTAAGGCAAAGAAGAAGAGTTGG
ACCAAAGTAAAGATAAAGGAAAAGCTTAACAATGCTGTCTTCCTCGATGCCAAGGCCTAC
GAGAGAATCGTGAAGGAAGCACCCAAGTTCCAAAATCTCACTGTTTCCATTGTCAGCGAT
AAATTCAAGGTTAATGGAGCTGTTGCTAGAAAAGTGCTCAGAGACCTCCACGCAAAGGCT
CTTATCAAGCAAGTGGGAGACCATCACAGTTCTTTCACTTTGTACACTGGTACTCAACTC
AAGGCTGCTGAGGCCGCACCAGCCAAGAAAACACAAGCCAAGGAAGCCAAGGAAGCTAAG
GAAGCACCAGCCAAGGAATGA


>Contig12351.0.g55(protein)
MGPKQQKGKDAKGGKGDKGGKSSASAVNKKAGGKAKKKSWTKVKIKEKLNNAVFLDAKAY
ERIVKEAPKFQNLTVSIVSDKFKVNGAVARKVLRDLHAKALIKQVGDHHSSFTLYTGTQL
KAAEAAPAKKTQAKEAKEAKEAPAKE