Identifiers and Description

Gene Model Identifier

Contig1218.0.g9

Standard Name

None

Aliases

Contig1218_0_g9

Description

C2 domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002258707.000924640675686e-24XYPPX repeat family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1218.0.g9(coding)
ATGCCAAAGTCAGCTAATCTGACAAGAGACACTGAGATATTTTCAAAGATGGATCCCTAT
GTTGTAATTAAAATAGGAAACTAAGAAAAAAAGTCATTAGTTCACAATGAAGGTGGCAAG
CATCCCAGATGGAATGAGACTTTTATGTTTGACATTACAAATGAAACTTGTTTAAATATC
ACAGTGATGGATAAAGATATGGTAAATGACGATATTGTTGGCTCCACAAACGTTCCTCTC
GATGCAACTTTCAGAAGTGGGAAAACAAGCAGCTCCTATAACTTAAGTTACAAGGGTAAG
CAAGCAGGGTAATTATATATCGACATGGAGTTCTACAATCACAGTCATTTAGGCTAGCCT
TAATCTTAATTACTTCCTGGTCAGCACAGTATGATGCCTGGTTAAATCTAAGGAGGTCCA
TCTCCAATAGCCTTCAACGTAGGATTAGGTATGTAGTAATAATACATGCAGCCTATGGGT
TATTACATGGCTCCACAACCATACTACGGAATGTAACAATAAATGCCAATGCCTTAGTAG
CAATTTGTGATGCCTCCATCTGGCTAATATCCAATGCAGTAGCAATAGCCAGTTTATCAA
GCTCCTATGGGGATGCCACCAGTTGGTTAAAATATGATATAGCCTCAACCGTTACCTATT
CCAAACTAAGTTGGACAACCACAGGCACAGCAATTCTATCCTCAGATTAATCAAATGTAA
CCCCCACAATATTTCCCATAGTAAAATGCAGCTTAGGTTCCTCCAGGATATAATCCTCCC
TAACAGATGTATCCACCATAGAATAATCATCCATATAATTACTAGTAAAGATGA


>Contig1218.0.g9(protein)
MPKSANLTRDTEIFSKMDPYVVIKIGNQEKKSLVHNEGGKHPRWNETFMFDITNETCLNI
TVMDKDMVNDDIVGSTNVPLDATFRSGKTSSSYNLSYKGKQAGQLYIDMEFYNHSHLGQP
QSQLLPGQHSMMPGQIQGGPSPIAFNVGLGMQQQYMQPMGYYMAPQPYYGMQQQMPMPQQ
QFVMPPSGQYPMQQQQPVYQAPMGMPPVGQNMIQPQPLPIPNQVGQPQAQQFYPQINQMQ
PPQYFPQQNAAQVPPGYNPPQQMYPPQNNHPYNYQQR