Identifiers and Description

Gene Model Identifier

Contig12085.0.g32

Standard Name

None

Aliases

Contig12085_0_g32

Description

Kinesin motor domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001521709.997093137033517e-262Kinesin motor domain containin
g protein
SGDYBL063W3.000809166761476e-75KIP1 SGDID:S000000159, Chr II
from 101886-105221, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12085.0.g32(coding)
ATGATAGCTCAGTAGTAATAATAGCAACAGCAACAATCACAAATACAGCTACAGTAGCAA
TAAAACCAGGCTTCTTTCGGCATGACTCCATAGCAATTCTAAATGCAATAGTAGCAAACA
CAAGTGTCTTCTGCATAGCAATAATAAAATCTTCTGCTTTAATCACCAGGACAAGGCAAT
GGTAATGTGTCATTGGCATCTACAAGTGCCAACATTATTCAGTAGCTACGTGGGTAGAAC
AGTGCAAGTGGTAGTTCTGTGAGCAGCAGTAATAATAATGAGAGTGCGATTTAGAACAAC
CCATACCTTCAGTAGTAGATGCAGCTTATTAGAAACTAACAGACTTAACAGTAACAATAG
AATAATCAATAGCAAAACACTCTTTTGTACTAGTAATAGCAGCAATAAGTCAATAAAAAT
CTAGGAAATTTAAACATTCATTAATAGCAACAGTAGCACGTTCCCTATCATTAAATGATT
CAACAGACACCTTAATCCAATAATAATAGCAATCAACTTTACAATAATGATCAAAATACA
CCACAAGGATCATTCTTATCACCACAGTAGCAGCAAACTCCATAGTAAAATTTCACTTAA
GGCATGATGCTTCACAACCAAAACTTAAACTCCTTAACCTAGTCAATTTCCTCACAATAT
ACGCAAAATCCAAATGCAAACTAGAATTTCAAAGTTGTTATCAGAGTGAGGCCACCACTG
CCTAGAGAAATGACTGATAATTTGGAGTTTATGCCTGTTTCATAGGTCTCCCCGGATAAT
AAAAGCTGTAGTATTTAGGAATATCTTGGAGCAGAGGTTACTGAGTATGGCAGGCAAAGA
GACATAAATGAAAATCCACACATAACCACAACCCACTAATTTTCATTCGATTACGTCTAC
GGTGCAGATTCAACTCAATCAAATGTTTATGAAAATACAGCCAGACCAGCAGTTTTAAGT
GTCCTTGAAGGTTACAATGCTACTATTTTGGCTTATGGATAGACAGGTACAGGTAAAACC
TACACTATGGAGGGCTTTAAATACCATCAAAACGATCCACAGAGAGGTATCATTCCCAGA
GCCATGGAGGAAATATTCAGATACATTCAAAATGGAGCAAATATGCACTCTACTTTTATG
GTCAGAGCCAGCTATTTGCAGATTTACAATGAAAACATCAGTGACTTGCTTAAAACTGAT
AGGTCATCCCTTTAGATTAGAGAAGATAAGAAAAGAGGAGTGTTTGTGGAGGGCCTGAGT
GAATGGGCTGTCCGCACACCTCATGAAATTTACAGTTTGATGTAACGAGGAGCTATGGTT
AGAGCTACAGCTGCCACTAAAATGAATGATGTTTCTTCAAGATCGCATGCTGTCTTCATT
ATGATAGTAGAGCAGATGAACATGGTAAATGATGGTAGTGATATGCATAAGCAGATCAAA
GTTGGAAAGCTCAATCTTGTAGATCTAGCTGGTAGCGAGAGAGTCAGAGTTACTGGAGCC
ACTGGCAAGAGACTTGAAGAGTGCAAGAAAATCAATCAATCTTTATCAGCATTGGGAAAT
GTGATTGCAGCCTTGACAGACATGAAAGCCAGAAATCATATCCCCTATCGTGACAGCAAG
CTTACTAGATTGCTAGAAGATTCACTTGGTGGAAATTGTAAAACCACCATGATGGCTATG
GTTTCTCCTGCTTTTGATTCATTCAATGAAAGTTTGAGCACATTGAAATTTGCAACTAGA
GCGAAAAAGATTAAAAATGAAGCCAGAATAAATGAAGATGTCGACCAGAGAACTTTACTC
AGAAAATACGAGAATGAGTTAAAGAAGTTGAGAGAAGAACTAGAATTAAGATCATAAAAT
GTGGTTGATAAGGAAAGTGTACTCAGATTGGAATAACAAAAGAGAAGAGCAGAGGAAGAT
AAATAAGCTGCAATTATTGCTCTTGAAACCAGATCAAGAGAATTCATGATGGAAAAAGAA
GAAAAAAAGAAACTCGAAGAAAAGATAAAAATGCTGAATTCACAGCTGCTAATTGGTGGT
AAAAAGATCGAGGATACCCCTCAATTTAAGTCTGCTCTAGAGGAGAAACAAAGAATTATT
AGATAAGAATATGAGTCAAAGCTTGGTGAACTGGAAAGAGAAAGATAGCAGATAGAAGAG
GATAAGGCACAGGTAGACAGATATAAATAATTGCTGCTCAAGTAGAGAGACATTATGATT
GCACTTACAGCCAGACTTAATGAACGAGATGAGACTATTATTTAGTTGCAAGAAGAGCTA
GATGCTTATGAAAGAATTCACAGAGAGACTGAAATAGCTGTTGATAAGAAACAAGACAGA
ATCATGCAATTAGAGCATGTAATGCAGCAAAGAGGTGTGGAAATACCATATGACGAAGAG
GGCGCAGATAGACCCCTTCACCACTTAAACTACAACGACTAAAACCTTCAAGACCAAGCA
GATTAAGCCCGTAAATACCTGCCACACGAGCAAATGCATCTAGACAACAACAAGGACGAC
GGTGAGGACAACGTGAATGTGGATGTTCCTCTGCAGCTTATGACAGCAGATGAGAAAGTT
GATGAATTGCAAAATTTACTAGAACACAGAGACAACGAAATGGAGGAGATTCGCATGTAA
CTGTAGTAATCCATCTAGCCTGACCAGTTGAAGGAACGTGTCGAGTAAATCGTGTAGAAA
GAAGTGGAGGAGAGAGTTAGAACCATTCATTAAGCCATGTAACTGCAGCAATAGCAGTAG
AACAGTGCTGGAGGGGACTCTGGCAGTTCATTAAGCTCAGCTAGTAACTAACAGCAAGCA
TAGTAGTTGTAATACATGGAGAAGAAACTTAAGATATCTGAAGAGAAGAATGACGCACTT
AAAAACCTTCTTACTTCTAAAGACGATGAAATAGACCGAGTTTTACAGTAAAAAGTAGCT
CTCACTAATCTCTTCGAAAATGATTTGCTGTAAATGACAGATAAATTAATTGGAAACGTC
CGCTAAGTGAGATCTCAAGATGACATTACTCAAATGTCAAATGACATGTAGAATCTCCAA
AAACTTATAGCTGTTAGCTTCCAAGCACTAAAAGGCAGTATGATGACTAAGTCATAGTAA
TAGCAATAGTAGTAAAATAATAATAATAGTTCAAACTTGCCACTACAGAGACCTTAGCAG
TAGTAAAGCTTAAATTCTCAGTAAAATTCTCTATAATCCTCATAGAAGAAATTAATTGAG
AAGGAAAATTCAGTTTAGCACAATCCTTCGCTAAGATCTTCTAGTGGTCAAAGTCACCAT
CAACCTAGTAATAACGACAGTATAAACAACAGCACAAGCAAGTAATAGCAATAATAAATC
CCTTAGGCAATCGATTAAATGCTTCATTAGAGATATCTAATGCAATAAATGCAGTAATAA
TAACAATAAAGATATTAATGA


>Contig12085.0.g32(protein)
MIAQQQQQQQQQSQIQLQQQQNQASFGMTPQQFQMQQQQTQVSSAQQQQNLLLQSPGQGN
GNVSLASTSANIIQQLRGQNSASGSSVSSSNNNESAIQNNPYLQQQMQLIRNQQTQQQQQ
NNQQQNTLLYQQQQQQVNKNLGNLNIHQQQQQHVPYHQMIQQTPQSNNNSNQLYNNDQNT
PQGSFLSPQQQQTPQQNFTQGMMLHNQNLNSLTQSISSQYTQNPNANQNFKVVIRVRPPL
PREMTDNLEFMPVSQVSPDNKSCSIQEYLGAEVTEYGRQRDINENPHITTTHQFSFDYVY
GADSTQSNVYENTARPAVLSVLEGYNATILAYGQTGTGKTYTMEGFKYHQNDPQRGIIPR
AMEEIFRYIQNGANMHSTFMVRASYLQIYNENISDLLKTDRSSLQIREDKKRGVFVEGLS
EWAVRTPHEIYSLMQRGAMVRATAATKMNDVSSRSHAVFIMIVEQMNMVNDGSDMHKQIK
VGKLNLVDLAGSERVRVTGATGKRLEECKKINQSLSALGNVIAALTDMKARNHIPYRDSK
LTRLLEDSLGGNCKTTMMAMVSPAFDSFNESLSTLKFATRAKKIKNEARINEDVDQRTLL
RKYENELKKLREELELRSQNVVDKESVLRLEQQKRRAEEDKQAAIIALETRSREFMMEKE
EKKKLEEKIKMLNSQLLIGGKKIEDTPQFKSALEEKQRIIRQEYESKLGELERERQQIEE
DKAQVDRYKQLLLKQRDIMIALTARLNERDETIIQLQEELDAYERIHRETEIAVDKKQDR
IMQLEHVMQQRGVEIPYDEEGADRPLHHLNYNDQNLQDQADQARKYLPHEQMHLDNNKDD
GEDNVNVDVPLQLMTADEKVDELQNLLEHRDNEMEEIRMQLQQSIQPDQLKERVEQIVQK
EVEERVRTIHQAMQLQQQQQNSAGGDSGSSLSSASNQQQAQQLQYMEKKLKISEEKNDAL
KNLLTSKDDEIDRVLQQKVALTNLFENDLLQMTDKLIGNVRQVRSQDDITQMSNDMQNLQ
KLIAVSFQALKGSMMTKSQQQQQQQNNNNSSNLPLQRPQQQQSLNSQQNSLQSSQKKLIE
KENSVQHNPSLRSSSGQSHHQPSNNDSINNSTSKQQQQQIPQAIDQMLHQRYLMQQMQQQ
QQQRYQ