Identifiers and Description

Gene Model Identifier

Contig12034.0.g94

Standard Name

None

Aliases

Contig12034_0_g94

Description

EB1-like C-terminal motif

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam03271 ) EB1-like C-terminal motif
  • ( pfam00307 ) Calponin homology (CH) domain
  • ( pfam11414 ) Adenomatous polyposis coli tumour suppressor protein
  • ( pfam06580 ) Histidine kinase

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005584609.999142814001536e-47EB1 protein
SGDYER016W5.999907735769095e-44BIM1 SGDID:S000000818, Chr V f
rom 188277-189311, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12034.0.g94(coding)
ATGTCTGGTGACAATATTGGTATGATGGAAGGAGCCTTCTTCGTAGGTCGTGGTGAACTC
CTATCCTGGGTTAACGAGACTTTTTAGTTGAATTTGACAAAGGTCGAGTAGGTAGCCACA
GGTGCAGTTTACTGCCAGATTATAGATGCAATCTACCCCAACACAGTGCAGATGGGAAAA
GTCAAGTGGCAGGCAAAACATGATTACGAATACGTTGAAAATTACAAAGTTCTTCAATAA
GCTTTTGCTAAGAATGAAATCAAAAGATATATCGATGTAGATAAGCTTACAAAGGCAAAA
TATCAAGATAACCTAGAGTTATTGCAGTGGTTGAAGAGGTATTTCGATATTAACTATAAC
GGTGAGCCATACGATCCAGTTGGCAGACGTAAGGGCCAGGATTTGTACTATATTTTGGGT
GGAAATAAAGTAGGTTCAGCTCAAGGTGCTGGCGTCAAGGCCTCTGCAGGGGCTAGAACC
TTGCCCTCTTCCAAGCCAAGTGGCAGCTCTGCTTAGCCCAAGCCAAGCGCTATGGGTTCT
GCACTTGGAGCTGGCTTGAAATCTAAAGTGTCAGCAGCCGGAGGAGCAGGAGCAATTGCA
GCTGCAGATACTAAAGCACTACAAGCTGAAGTTTCAGATTTAAAGATGAATATGGACACA
CTTGAGAAGGAGAGAGACTTTTACTTTGCTAAGCTTAGGGACATCGAGATGTTGATGCAG
GTTAACCCCTCTCAAGCTAATCCACTCACTGAGAATATCCTTAAAATCTTATATGCTAGT
GAGGAGGAGAAAGTTCACATTGAGGAAGATGGAACACTAACAATTACAGGTGGTGGAGCT
TAAAATCAAGGTGGAGACGAAGACATGCTTAACGAAGAGGAAAACAAGGATGACGACGAG
AGCCTGGTGTGA


>Contig12034.0.g94(protein)
MSGDNIGMMEGAFFVGRGELLSWVNETFQLNLTKVEQVATGAVYCQIIDAIYPNTVQMGK
VKWQAKHDYEYVENYKVLQQAFAKNEIKRYIDVDKLTKAKYQDNLELLQWLKRYFDINYN
GEPYDPVGRRKGQDLYYILGGNKVGSAQGAGVKASAGARTLPSSKPSGSSAQPKPSAMGS
ALGAGLKSKVSAAGGAGAIAAADTKALQAEVSDLKMNMDTLEKERDFYFAKLRDIEMLMQ
VNPSQANPLTENILKILYASEEEKVHIEEDGTLTITGGGAQNQGGDEDMLNEEENKDDDE
SLV