Identifiers and Description

Gene Model Identifier

Contig1188.1.g66

Standard Name

None

Aliases

Contig1188_1_g66

Description

Peptidase family M3

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006861404.998978211117678e-38acetyltransferase, GNAT family
protein
SGDYKL134C0.0000000020002373268528243OCT1 SGDID:S000001617, Chr XI
from 191442-189124, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1188.1.g66(coding)
ATGCTTGATGATTAAGACAGATTTCTCCTTCATTAAGCAATATAAGATCTTAACTCACAG
TAAAAAATCAATGATCCTCTAAAGCTGTAAAGAATGTAGGAAATTGATGGGGAGATACAT
GCTTTACAGAGGAGATTTATGAGAAATTTATCACAAGATTAGTACTAGCTTAGCTTAACA
TAAAGTGAATTGAAATCTATTCCAAACAGACAACTTTAAAATAAGTACTAGGCTTTATTT
AAGAATGAAACTGAGAAACTACCTATCATATTTGACAAGAAATATGAATTCGAAGTGGCT
AAGTTTTCTCCTATGCCTAGTGTAAGAAGACAGTTCTTTTTATAGTATGCGAATACAAAC
AAGTCAAACACATAAGAAGTCATAAAATTAGTAGAGCTTAGAAGAGAACTTGGAACGTAA
ATTTATCAAGAAAAAAGTTACTTTGACAAACAAAAGAAATTGCAAAGTCTTAAATTTAAG
AGAGAATTGAAAGAAATTATTTATGAAATTCAACAATAAATTAGACCATAATGTATAAAG
GATATAGAAAATATTAAAAGAATCACTGGCGAGCTAGACGTTAGATATTACGATATTGCC
TTTTTAAAAGAAAAAGTTAAAGCCATTATGCTTTCATAAGATCCTAATAACATTCAAATG
CTCACTTGCTTTACACTTTAAAATACATTTAGAGGCCTAATGATTTTAGCAGCTTAAGTA
TTTTAGTAAACTGGATTGAAACTGTACACAGTAATCTATAATTAGGAAACAGGCAAATCT
GAAAGGCTAAATGGCTATTAATTATTCACAAAACTTATAACCAAGCTTAATCCAAATGAG
ATCCCTCTTATTGAAGTAACCCTGAAAGATGGTGGTAAAATTATTATGGATATCTTCTAT
AGGCCTTTCAAGCTTCATAAAAATCAAACCTAGACTTTAACAGAGCAAGGATCGAACCTA
TTTCAAAGACCAGTAGCATATCTTTTAGAAAGTTTACCCATAGATACTAATTATCTGAGT
TATGATTAAGTAAAAAACTTGTTTCATGAATTTGGACATGCCTTAAACATTGCACTCTCT
AAGACCAAATATCAATATTATAGTGGAGCGAGGGCAACTTTGGATTTAGTTGAAACACCT
TCACATCTAACAGAATTGTTCTTGAAAGATTATTATTTCGTGTAAGGGTTCGCTTTTAAT
GAATCAAATGTACCAATATCAAGAGAAATTTTCAATAAAATGATATTTTGCGATGAATTA
TTTAGATTACTCAATTTAGAAGAGACTTTGTATTTTACACTGCTTGATCTTGAATTGAAT
TCATTCTAAAAGGGATAAAAATTAGATGAGAATAAATTGATTGAAATAAACAAAGATTTA
CTAACTCAATCTTTTTCATGCAATTATAGCTTGATCCTTCAAAAGTATAAGACTATGAAA
ATAACTATTTATTCAACAAATTTCATCATTTATTTGAATATGATGCTACTTACTATTCTT
ACCTTATTGCTAAGATATGCTCTCAAAGAATATACTTGGATAATTTTCGAGGATTAAATA
AATCAAACTTTAAAATTGGGAAGGAAGCTATTGAATTATTTGAAAACGGTGGCTACTTCA
AACCAAAAGAATTTAATATATGATCAATTAATGGAAGGCAGCTCATAACAAGTGGAAACT
TAAGATTAAGTCAACAGAGTTAACAAACTGAAAATTCCAGTTGAAATTGAACTTCCAGGA
GCTGAGGAGAGAGTATTCGAAAACTAAGTTACTACCAAGCCAGAGACTAGAAAGTTACAA
AAGCTAGACCTTAAATTTGGAGATTTGACAGACAAGAATGTTGAGCAATTTAGAATCCTA
AATTACATGAATCTCCCTGTTATCTACTCAGAAGACTTCTACCGCAGATTGATCAGCTTT
ACTAGATACTCTAAGCTTGCCTACTTAAAAGATGTCTTAATTGGAGCAATCTCATGTAAG
GAGGATTCTTATGAAGGGGAAAAGGCTGTATATATTATGACTATCACAGTTTTGAAGCCT
TATAGAAGATATGGCATTGCAAGCTAGCTCTTGGAATAGGCAGTAGAGGATTGTGCAAAG
AAACACAGCATAAAGAAGATGATGTTGCACGTTTAGTGCAGTAATGACAGTGCACTTGAG
TTTTACAAGAAGCACGGCTTTGAAGTATTACAAAAATTGGAAGATTACTACACTGACCTA
GATCCCCCACACTGTTTTGTGCTTGTAAAAAATCTTGAATTTTGA


>Contig1188.1.g66(protein)
MLDDQDRFLLHQAIQDLNSQQKINDPLKLQRMQEIDGEIHALQRRFMRNLSQDQYQLSLT
QSELKSIPNRQLQNKYQALFKNETEKLPIIFDKKYEFEVAKFSPMPSVRRQFFLQYANTN
KSNTQEVIKLVELRRELGTQIYQEKSYFDKQKKLQSLKFKRELKEIIYEIQQQIRPQCIK
DIENIKRITGELDVRYYDIAFLKEKVKAIMLSQDPNNIQMLTCFTLQNTFRGLMILAAQV
FQQTGLKLYTVIYNQETGKSERLNGYQLFTKLITKLNPNEIPLIEVTLKDGGKIIMDIFY
RPFKLHKNQTQTLTEQGSNLFQRPVAYLLESLPIDTNYLSYDQVKNLFHEFGHALNIALS
KTKYQYYSGARATLDLVETPSHLTELFLKDYYFVQGFAFNESNVPISREIFNKMIFCDEL
FRLLNLEETLYFTLLDLELNSFQKGQKLDENKLIEINKDLLTQSFSCNYSLILQKYKTMK
ITIYSTNFIIYLNMMLLTILTLLLRYALKEYTWIIFEDQINQTLKLGRKLLNYLKTVATS
NQKNLIYDQLMEGSSQQVETQDQVNRVNKLKIPVEIELPGAEERVFENQVTTKPETRKLQ
KLDLKFGDLTDKNVEQFRILNYMNLPVIYSEDFYRRLISFTRYSKLAYLKDVLIGAISCK
EDSYEGEKAVYIMTITVLKPYRRYGIASQLLEQAVEDCAKKHSIKKMMLHVQCSNDSALE
FYKKHGFEVLQKLEDYYTDLDPPHCFVLVKNLEF