Identifiers and Description

Gene Model Identifier

Contig11784.0.g11

Standard Name

None

Aliases

Contig11784_0_g11

Description

Reovirus sigma C capsid protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_013215404.000179013191958e-98hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11784.0.g11(coding)
ATGGCAACTGCTTAAGGTGCTCCTAGTAAGGACACACATCACAAAATGTCCAAAAAAATC
GCTTAATTAACCAAGGTTATTTTTCATCTGCATTCTAAAAATGAAGAAAATAGTTAATAC
CAAAATTCATTAACAGGTGCATACGAAAAAGAAATAGAAACAATCCTGCGTGAAGCAAAC
AACGTAATAAACCGTCAAAAAGACGCCCTCGACCGAGCCAAAGAGGGCTCCTCTCTAAAG
GAAAAAATGCGAGAATTAGAGGAAAAACACACTCAAGAGAAGAAAGAATCGCAGAAGCAG
TTTGAAGAGTATAAGAATCGAGTGAAGGACCGGGAAGGGCAGGTGGAGAAAGATTATCAG
TTGAAAGTGAATGAGTTTAAACTGGAGGTACTAGACATGAAGAAGAAGTTTGACAGCAGA
GTCGATGAATTGAGGCGATAAATGGAGGATTACAAGAAAAGCAATGATGTAATTGATGAA
TTAAAGAAAGCTCATTAAAAAGAACTTCAAGCTTATATTCAAGAACACAATAAAAAGTAT
AACGAACTATTGAAAGATAAGTTGAATACTGAAGACGCCATGAAAGCTCAATTCGAATAA
GAAAAAGCCTAGATTATCAGAGACTGGGAGAAGAAACTCAAGGATGCTGTTGACAAAGCA
AGAAAAGAAGAGCAAGAGAAAGCCAGAGTTGACTAGGACAAGTTGAAGAAGGATTTCGAT
GGTAAATTTGAGATTATGGATGGCAAAGTCAAGAAGTTAGAGCTTGAAATCTAGGAGTTA
AACAGAAAAATCAAGGAGAAGGACACTGTAATAGGAGATAGAGACCGTACTATCGGGGAG
AGGGACTAGAAAATCAGGGATTTGGAGAAAGAATTAGCTAAATTAAATGATATGCTAGCT
AGTGGAGGACAAACTGCAAGTGATTTATAACAAAGGTTACAGTAAACTCAGTAGGAATTG
AGGGAAGCATAGGAATAAATAGAGTAATTGAAGAAATAACTGAGAGATAAATAGATGGAA
CTGGAGGATGAAAGAACCAGAATGTAGAAGGAAATCGATAGATTAAAGGATGCAATGAGT
AAGACAAGTGGCAGTTTACAGAATGAGTTGGCTTCCAGAGATGAAGAAATCTCTAAATTA
CAGAGAAAAGTTTAAGATTTAGAGAAGCAAATCCTAGACTTGAAGAGACAACTTGCTGAC
GAGCAGGATAAAAGCGAGAAAATGAAGCGAGATAACGAGAAAAAGATCAAAGATCTGGAG
GATTAGATAAATATGCTCAAGAGTGAAAGTGGGGATGTTGTACAGCAACTTGAACGAAAA
ATTAAACAAATGATTGAGGAGCATGAACAAGAAAAAGAGCAGTTGCAAAGACAGTCAATT
AGGGAGAGAGAAGACATAATAAGCGAGAATGACAGGAAAATGCAAGGATTAATTGATGAA
TATGAGAGGAAGCTAAGAGAATTGGAGCAAGTTAAGACTAGGGAGTTTGACTAGATGAAG
CAAGAAATGGAAAGGAGGATCAAAGACTTAGAGGACTTACTTAGAAGGGAAAGAGAAAAT
CTGGAGGGTAACGCAAAAGAAAGGGAATAGTAATTGAAGAGAGAAGTCGAAGAATGGAAG
TAGAAACTAGCAGATAAATAGAAAGAATTGGATGATGCGAGAGCTGAGATTAGTCAATTG
AGCAGAGATAAGTAAATGCTTAATGGAGAAATAGACGATTTGAAGCGTACTATCTCTTAA
CTTGAGCAGACCATAGCCCGCTTAGAAGAAGAACTTCGCCTTGCAAGAGAAAATCTAGAG
GCCAACTCAGGCTAATTATCATCTGAGCTAGAACGACTAAAGTAAGAACTTGAGAAGCAG
CGTAAACAATTCCAGCAAGACATATCTGATATCACTGAGAGATTAAAAGCTCAAAAAGAG
TAGGAATTGGAGTAGCAAAGACTCAAGTATGAGAAGATGATTGATGAAATGAAGAGAAAT
TCGCTTAATGACAGAGAGTTTGTTGCCAAAGAATTGCAAAAGCGCATTGATCAGTTAGAA
GCAGAATTGAAAAAGCTGAGAGATCAGTTTGATCAGGAGAGAGCTGATCTGTTGAGATAG
TAGCAAGAAATGAAGGATATGTATGAAAAGTAAATACAATAATTGAAGAATAACAGTGAA
GGAGACAGCAAGAAAATTAGGGAAGATTATGAAAGATAGATGAAGGAACTTAGAGCATAG
CATGAAAAAGAATTGAATGAATTGAGATAATAGCTAAACAGAGAAAAAGATCAAGCAGTT
CAGCAAGAAGTAACTGTTAAAGAGCAAGCAATATAAAAGCTGAAAGAAGAACAAGAAAAA
CTAATTGAAAATCTCAATTCTAACTTTGACCGTACTCTAGATAAGAAGTAAAAAGAGCAT
GAAAAAGCCCTATAAGATTTGCAAAAAGAGAGAGAAAAAGAGTAAGAAGATAACCAACGC
AGGGAAAAAGAGCTCCTGAAAAAGATTTCAGAACTCTCTTCAGAAATTACTCATCTCAAG
TCAGAAGTAAAAGATCTTTCAACCAAGCTCCATGATAAAGACTACGAGATCAAGTAGATG
CAGGAGAGAGTAAAGGAAGCTGAAAGTATCATGAAAGAAGAGAAGTAGAAGTGCAAGGAT
CGCATTAAAGAAATCGAGGATGAATTCAATATGAAAGAGAGAAGTCTCATGGACAAGCTT
AAGAAAGATATGAACCAGCTGATCTAAGAGCAAATGCGTGAGATGTAAGAGATGCAGTCT
GAATTTGGACAAGCCACAGAGTTGATGGACTAGAAATACCGTCAACTCAATGACAGATTT
ATGGAACTTTAAGAGCTCTACGAAAACAGACCAAGCAGACCAGAGGACCTTGAAATGATC
AGGCAGTTACAAGAAGAAATCATTTAGAAAGATAATGCACTGAAGAAAGCTGCTGAAGAC
ATGAAATTCTACAAACTGGAACTGATAAACAGAGAAGATAATTTCAATAAAATGTTTGGT
ACAAACCCCAATGTGGGTGTTATAAATCCTTTAGGATAAAAACCACAAACTGGCAAGCAA
ACAATAATTGGAGGAAAAGGCATGCCAGGCATGGGAATGGGCATTGGAGGTATGGGCATG
GGCTTGACTGGAAACACACCCGCTAATGCTATGAGTCTCAAGGATGGTCGCAAAAATTCA
AGAATGGTACAGTGA


>Contig11784.0.g11(protein)
MATAQGAPSKDTHHKMSKKIAQLTKVIFHLHSKNEENSQYQNSLTGAYEKEIETILREAN
NVINRQKDALDRAKEGSSLKEKMRELEEKHTQEKKESQKQFEEYKNRVKDREGQVEKDYQ
LKVNEFKLEVLDMKKKFDSRVDELRRQMEDYKKSNDVIDELKKAHQKELQAYIQEHNKKY
NELLKDKLNTEDAMKAQFEQEKAQIIRDWEKKLKDAVDKARKEEQEKARVDQDKLKKDFD
GKFEIMDGKVKKLELEIQELNRKIKEKDTVIGDRDRTIGERDQKIRDLEKELAKLNDMLA
SGGQTASDLQQRLQQTQQELREAQEQIEQLKKQLRDKQMELEDERTRMQKEIDRLKDAMS
KTSGSLQNELASRDEEISKLQRKVQDLEKQILDLKRQLADEQDKSEKMKRDNEKKIKDLE
DQINMLKSESGDVVQQLERKIKQMIEEHEQEKEQLQRQSIREREDIISENDRKMQGLIDE
YERKLRELEQVKTREFDQMKQEMERRIKDLEDLLRRERENLEGNAKEREQQLKREVEEWK
QKLADKQKELDDARAEISQLSRDKQMLNGEIDDLKRTISQLEQTIARLEEELRLARENLE
ANSGQLSSELERLKQELEKQRKQFQQDISDITERLKAQKEQELEQQRLKYEKMIDEMKRN
SLNDREFVAKELQKRIDQLEAELKKLRDQFDQERADLLRQQQEMKDMYEKQIQQLKNNSE
GDSKKIREDYERQMKELRAQHEKELNELRQQLNREKDQAVQQEVTVKEQAIQKLKEEQEK
LIENLNSNFDRTLDKKQKEHEKALQDLQKEREKEQEDNQRREKELLKKISELSSEITHLK
SEVKDLSTKLHDKDYEIKQMQERVKEAESIMKEEKQKCKDRIKEIEDEFNMKERSLMDKL
KKDMNQLIQEQMREMQEMQSEFGQATELMDQKYRQLNDRFMELQELYENRPSRPEDLEMI
RQLQEEIIQKDNALKKAAEDMKFYKLELINREDNFNKMFGTNPNVGVINPLGQKPQTGKQ
TIIGGKGMPGMGMGIGGMGMGLTGNTPANAMSLKDGRKNSRMVQ