Identifiers and Description

Gene Model Identifier

Contig11781.0.0.g15

Standard Name

None

Aliases

Contig11781_0_0_g15

Description

Calcineurin-like phosphoesterase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00149 ) Calcineurin-like phosphoesterase

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002388309.997093137033517e-262Serine/threonine protein phosp
hatase PP1, put...
SGDYER133W9.997093137033517e-262GLC7 SGDID:S000000935, Chr V f
rom 432495-432671,433197-...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11781.0.0.g15(coding)
ATGGTAGACCAAGGAAAGGACATCGATATCGATGCTATTATTGACAAGCTCCTCGAAGTT
AGAGGATGCCGCCCAGGCAAGTAAGTCAACCTTACAGAGCAAGAAGTCAGAGGCCTTTGC
CTTAAATCCAGAGACATCTTTATTAACTAACCCATTCTTTTGGAGTTGGAGGCTCCCATC
AAGATTTGCGGTGATGTACATGGTCAGTATTACGATTTACTCAGACTGTTCGAGTACGGT
GGATTCCCACCCGATGCCAACTACCTTTTCCTCGGAGATTACGTTGATAGAGGCAAATAA
AGTTTAGAGACTGTGTGCCTTCTCCTCGCATATAAAATTAAGTACCCAGAAAACTTTTTC
TTATTGAGAGGTAACCACGAGTGCGCATCAATTAATAGAATCTACGGTTTTTACGATGAG
TGCAAGCGTAGATACAACATCAAGCTCTGGAAAACATTCACTGATTGTTTCAATTGCCTT
CCTATTGCTGCCATTATTGACGAAAAAATCCTCTGCATGCACGGAGGTCTCTCACCAGAG
CTTTCATCCCTCGAGCAAATCAAGAGAATTATGAGACCAACTGATGTTCCAGATACTGGT
CTTCTCTGCGATTTACTCTGGTCTGACCCAGACAAGGATGTCTAAGGTTGGGGAGAAAAC
GATCGTGGTGTATCATTCACATTTGGTCAGGAAATTGTTTCAGCTTTCAACAAAAAGCAT
GATATTGATTTGATCTGCAGAGCTCATTAGGTAGTCGAAGACGGTTATGAATTCTTTGCC
AAGAGACAACTTGTCACTCTTTTCTCAGCTCCAAACTACTGTGGTGAATTCGATAACGCT
GGTGCTATGATGTCAGTTGATGATACACTCATGTGCAGTTTCCAGATTCTCAAGCCTGCT
GAAAAGAAACAAAAGTTCACATATGGAGGTATGGGAGCCGGTAGACCAATCACTCCCCCA
AGAGCTAAATACTGA


>Contig11781.0.0.g15(protein)
MVDQGKDIDIDAIIDKLLEVRGCRPGKQVNLTEQEVRGLCLKSRDIFINQPILLELEAPI
KICGDVHGQYYDLLRLFEYGGFPPDANYLFLGDYVDRGKQSLETVCLLLAYKIKYPENFF
LLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKILCMHGGLSPE
LSSLEQIKRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGQEIVSAFNKKH
DIDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPA
EKKQKFTYGGMGAGRPITPPRAKY