Identifiers and Description

Gene Model Identifier

Contig11687.0.g111

Standard Name

None

Aliases

Contig11687_0_g111

Description

Aspartyl protease

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003357201.000371485572848e-69UBA/TS-N domain containing pro
tein
SGDYER143W6.001376218974307e-41DDI1 SGDID:S000000945, Chr V f
rom 456319-457605, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11687.0.g111(coding)
ATGAGACTAACAGTGTAAAATATGACCAACGAAGACCAATTCTATCAAGTAGAGATAGAA
GACAATGGAACAGTGGAAGACATTAAGTTAATCTTGAGTGCAGAGTCAAACATTGATGTT
GAATTTTAAGTTTTACTCGCAAATGGAAAAGTGTTGGGTAATGATAGTATGAAGGCATCT
GCAGCTGGACTAAAAAATGATGATATGATTATGCTTACTGATTAGAGGACTGTAATGGCA
GCTTAAGGATCAAGGTTTGGAGGAGCAGGCATGGGAAATATGTTTGGAGGAGGTTAACAA
AGATAATAATAGCAGTAGAGACCAGTTGCTTAGGTTTAACCAAATGCAAATCTTAATCCA
AATGATGCAAATCTTTTGAGTAGTTTCTTCACTGATCTCTCATAACAACGAGTTGCCTAA
CCTACCAGCGCAAGAAGATAAGGAGGCTCAATGGGATTGTCTGAAGCTCAATTATAAATG
GTTGTTCGTCAAAGAGCATTAGAAACAAAGCAGTATTACTTGTCTAATGAGACTTAACTT
AACTATATTTTGCATTAAGATCCAGAATTAGGAGGTGCTATCGCAGCTGAAGATGACGAA
AAGCTTTTCTAAGTTATTAGAGCGAGGTTGCTTGATAAATTCGAAAGAGAACGCAAAGAG
AAGGAGAAAATGCATAGATTAGCTAATGCAGATGTTTTCGATGTTGAAGCTTAGAAGTAG
ATCGAAGAAGAAATAAGAAAGAAGCTTGTGGAGGAGAATTACGAAATGGCATAGGAAAAT
TTCCCAGAGTTCTTCGGACAAATAACTATGTTATACATTAACTGTAAAGTAAATGGGCAA
GAGATTCAAGCATTCGTTGATAGTGGGGCACAGAGTACTATCATCTCAAAGGCTCTCGCT
GAAAAGATAGGCTTGATTAAGCTTATGGATACTAGATTTGCAGGTATGGCTATTGGTGTA
GGAAGTTCAAGAATTCTTGGAAGAGTGCATGCAGCTAACATGGAAATATTGGGATAAACT
TTTGTTTGCTCCTTCACTGTCCTTGAGGACAATAAAGTAGATTTCTTATTCGGCTTAGAT
AATCTTAAAAGGCATCAGTGCTCGATCGACCTCGTTCATAACTAGTTGCATTTAAGAAAC
GGAGAAATCTCGATTCCATTCTTGTCTGAAGGTGAAATTAAGAAGAATGAGTTCGAAGAG
GAAAAAGAAGCTTTTCTTGAAAAGCAGAAATCTATGGGTTCCAAGTTTAATGAGGAGGAC
TTAAAAGAACTTATGGAGGTCAGTGGAGCAACAAGAGCTCAAGCTGAAGAAGCTCTTGTA
ATCAATGACGGTAATAAAGAGCATGCTGCCAATTACCTGATGAGCTAAAGTATGGCAAGA
AAGAGTCCTCAAAGAAAGTGA


>Contig11687.0.g111(protein)
MRLTVQNMTNEDQFYQVEIEDNGTVEDIKLILSAESNIDVEFQVLLANGKVLGNDSMKAS
AAGLKNDDMIMLTDQRTVMAAQGSRFGGAGMGNMFGGGQQRQQQQQRPVAQVQPNANLNP
NDANLLSSFFTDLSQQRVAQPTSARRQGGSMGLSEAQLQMVVRQRALETKQYYLSNETQL
NYILHQDPELGGAIAAEDDEKLFQVIRARLLDKFERERKEKEKMHRLANADVFDVEAQKQ
IEEEIRKKLVEENYEMAQENFPEFFGQITMLYINCKVNGQEIQAFVDSGAQSTIISKALA
EKIGLIKLMDTRFAGMAIGVGSSRILGRVHAANMEILGQTFVCSFTVLEDNKVDFLFGLD
NLKRHQCSIDLVHNQLHLRNGEISIPFLSEGEIKKNEFEEEKEAFLEKQKSMGSKFNEED
LKELMEVSGATRAQAEEALVINDGNKEHAANYLMSQSMARKSPQRK