Identifiers and Description

Gene Model Identifier

Contig11604.0.g35

Standard Name

None

Aliases

Contig11604_0_g35

Description

Adaptin N terminal region

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007157509.997093137033517e-262Adaptin N terminal region fami
ly protein
SGDYPR029C4.99929489534828e-74APL4 SGDID:S000006233, Chr XVI
from 626967-624469, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11604.0.g35(coding)
ATGTCAAATTTAAAGCTAAGAGAGGTCATTAAGCAAATCAGATCATGCAAGACAGCAGCT
GAAGAAAGAGCAGTTATCTCAAAGGAGTCAGCCCTTATCAGAAACGCATTCAAGGAAAAA
GATTGTGACCACCGTAACAGGAACATTGCCAAGTTACTTTTCTTCAACTTACTTGGGTAC
CCAACTCATTTCGGTTAAATTGAGTGCATTAAACTAGTAGCATAATCTAGTTACACAGAG
AAACGTATTGGATACTTGGGCTTATCACAATTATTGGATGAGAGCTCTGAAATACTCATG
ATGGTAACCAACCAAATCAAGAAAGATTTGAATGAGAAAGGTAATAATGCGCTTGTTTCT
CTTGGACTTACAGCCATCGCTGAAATCTCAACAGAACATATGTGCCGTGAACTTTACCCT
GAAGTCAAACGCCTTATGAAGAGCTCTTCTCCTTATATTAAGTAAAAAGCAGTCTTAGCA
GCAATTAGGACCATCAAAAATATTCCTGATACTATCGAGGACTTTTTGGAAATTATTGAT
TAACTTATATATGATAAGAGCCAAAGCGTCCTGCTTGCTACAACCACACTTATGACTGAA
ATCTTGAGAGTTGATGACTCGTATATCAAGCCATTCAGAAAATACATTACAGCCTTAGTC
CGTATCTTGAAAAACTTGCTTATGAGTGGATATAACCCAGAGTATGAAATCAGTGGTGTG
AAAGATCCCTTCCTCCAAGTTCGTATCTTGCAACTCTTGAAGCGTCTAGGAGAGAAGGAT
TCAGCAGGCTCCGACGAGATGAGTGATATTTTGGCTTAGATAGCTACTAACACTGAGTAA
ACTAAAAATCCAGGCAACTCAGTGCTTTCAGAGTGTGTCAGGACAATTATGGGTATCGAA
GCTAGTTAAGGATTAAGAGTCCTTGGTATCAATATCCTCGGTAGATTCTTAATGAACAGA
GAGAACAACGTCAGATTTGTCGCCTTGCAAGCACTACAGTAAGTGGTGGACATCGATTAT
AATGCTGTGAAAAGACATTAAGCTACAATTACAGATTGTCTTAAGGATCATGATTTGGTT
ATCAAGAAGAAGGCTTTAGATCTTTTGTACAAAATCACTAATCAATCAAATGTTAAATCC
ATCGTCAAGGAATTAGTTAATTATCTCTTGATTGCAGATTCAGAGTTTAAGAAGGAGCTT
TCAAACAAAATCTGTATGGCTTGTGAGAAATATGCTCCTAATAAGAAATGGCACATTGAT
ACTGTTATCAAAGTACTCACTCTTTCAGAGGGTCACGTTAGAGAAGAATTTATTTCTCAG
CTTATCACTGTAATCGCCACAACTCCCGATCTCCATTAGTATTCAGTCGTTAAGGCTTAC
TATGCTATGAAAGAAAACCTTAACTAAATTGGCATGGTTCAACTAGGTATTTGGCTTGTA
GGAGAATTCGGAGAGATGTTGGTTAACGGCACTGCTAAAGATCCAGATGGAAATCAAATT
GTAGTTGATGAAGATGAAATCATAGATGTGTACGAGAGAATACTCAACGACCATAACAAG
AAGGGCGAGCGTAGTGACACAATTATATGCTGGATTCTTACTGCTCTCTCTAAGTTAACA
ATTAGAATGAGAGGAATCCAGGATAAAGTCAAGGACCTCATTAAATTTTACACCACTCAC
ATGAACGTTGAAATCCAGCAGAGAGCTTGTGAGTTCTTGTAGTTGTTCGATAGCAAATGG
GATACTGAAAGAGTAGGTATTTTCGAGCCAATCCCTTTCAAGGGAGATGAGAATATGACT
GTCGATGCCACCAACAGACCTATCTTCGATGATGACGACCAAGAGAACTCCAATAACAAT
GGAAGCAGCAATTTCAACAACGGGTCAGATAACTTCGGAAGTGGGCAACCAAAGCAGAAG
AAAGCAGTCGAGACTAGCAACGCTGCACCCACAGACAACATGATTGATTTAGATATTATC
CTCAGTGGTGGCTATAGTCAACCCCAAAACTAAGCTCCTTAGTAGAATCAATCATCTGGT
GGTGTCAATCTAATTGATGATTTAATGGATGTGTTCGGAGGCAATAAACCTCAACAACAG
CAACAACAGCAATCTTATCAGTAAAATAACCTTCTTGGTGGTATAGACGATTTGATCGGA
ATGTCATCAACAGCTCCATCTAACAATTATGGCTACTAACAACAACAACCGCAACAGTAA
TAATAATAATAGTAGAAACCTGGCACAAGTTTCTTGGCTTATTAAGACCCCAATTTGACT
ATTAACTTCCAAATTTTGCGTGAGGATCCATAGACTCTTGCAGTCAAGGCATATTTCTCA
AACACATCTCAGCAGCAAGTGACAGGTGTGAACTTGCAAGTAGCTGTCTAGAAGTACATG
AAGCTTAATATCATGCAAGCCACAGGTCAAGATCTAAGACCACTATAATAAGACGGTCTC
ACTTAAGACATGAAGTTGAACAACTCTTTAGATGGATAGAAACCATACGCTTTAAAGATC
AGAGTTTTATATACCTTAACTCAAACTGGACAACAAGTCAATGAGACTAAGGTCATTAAC
GGACTTCCATAGGTTTGA


>Contig11604.0.g35(protein)
MSNLKLREVIKQIRSCKTAAEERAVISKESALIRNAFKEKDCDHRNRNIAKLLFFNLLGY
PTHFGQIECIKLVAQSSYTEKRIGYLGLSQLLDESSEILMMVTNQIKKDLNEKGNNALVS
LGLTAIAEISTEHMCRELYPEVKRLMKSSSPYIKQKAVLAAIRTIKNIPDTIEDFLEIID
QLIYDKSQSVLLATTTLMTEILRVDDSYIKPFRKYITALVRILKNLLMSGYNPEYEISGV
KDPFLQVRILQLLKRLGEKDSAGSDEMSDILAQIATNTEQTKNPGNSVLSECVRTIMGIE
ASQGLRVLGINILGRFLMNRENNVRFVALQALQQVVDIDYNAVKRHQATITDCLKDHDLV
IKKKALDLLYKITNQSNVKSIVKELVNYLLIADSEFKKELSNKICMACEKYAPNKKWHID
TVIKVLTLSEGHVREEFISQLITVIATTPDLHQYSVVKAYYAMKENLNQIGMVQLGIWLV
GEFGEMLVNGTAKDPDGNQIVVDEDEIIDVYERILNDHNKKGERSDTIICWILTALSKLT
IRMRGIQDKVKDLIKFYTTHMNVEIQQRACEFLQLFDSKWDTERVGIFEPIPFKGDENMT
VDATNRPIFDDDDQENSNNNGSSNFNNGSDNFGSGQPKQKKAVETSNAAPTDNMIDLDII
LSGGYSQPQNQAPQQNQSSGGVNLIDDLMDVFGGNKPQQQQQQQSYQQNNLLGGIDDLIG
MSSTAPSNNYGYQQQQPQQQQQQQQKPGTSFLAYQDPNLTINFQILREDPQTLAVKAYFS
NTSQQQVTGVNLQVAVQKYMKLNIMQATGQDLRPLQQDGLTQDMKLNNSLDGQKPYALKI
RVLYTLTQTGQQVNETKVINGLPQV