Identifiers and Description

Gene Model Identifier

Contig11500.0.g38

Standard Name

None

Aliases

Contig11500_0_g38

Description

Dynein light intermediate chain (DLIC)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam05783 ) Dynein light intermediate chain (DLIC)
  • ( pfam03029 ) Conserved hypothetical ATP binding protein
  • ( pfam05673 ) Protein of unknown function (DUF815)
  • ( pfam13191 ) AAA ATPase domain
  • ( pfam00009 ) Elongation factor Tu GTP binding domain
  • ( pfam04670 ) Gtr1/RagA G protein conserved region
  • ( pfam08477 ) Miro-like protein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002949404.000139296874041e-45Ras family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11500.0.g38(coding)
ATGAACATGATGGATGATAGTGATGTGAATGGATCATCTTCTCGCTATGGTAACATGAGT
CCAGAGTCTCGTCGGGGAACTTAAATGGAACGCAGAGATACAGTCTCTGGGGGAGGTGGC
ATATCAAATTCAAATTAAAAGATATTCAATGTTATCTAAAAGAACATACTAGAGTCTGGA
TAATCAAATTTATGGAAAGCGATATTGAATGATGTAACACAAAGAGATGACATAAAAGAA
TCTCATTTATTGGTGTTGGGAGATAGAGGCGCCGGAAAGAAGTCACTAATCTCAGCTGTA
AATAAGCATATCGTACGTGCAACAAATATGTTAATAAATGTTGATAAAATGGGTTCACAG
TACTCTGCATTAGATTCAGCATTTCTTTACGTGAAGGATTTAAGCGAGAAAGATGCGCTA
AATGAAAATGAATAAGTCCTCCCCTGCATGAACGTATGGATGTTGTAAGAACAAGACAAA
GCAGATTTAATAAAATAAGTGATAAAACCTGATGATTTGCAGCATACCTGTGCGTTAATA
GTCTTGGATTTCGATCAACCATGGGAAATGATGAATGCATTATAACGTTGGATGGGAGTA
TTAGGTGAAACTATACTGGACATAATGAAGCTGTTAAAGAGTAGCGAGCAGGATAAAATG
AAAGATCGTTTAACTAGATTCGTGAAGAACTTTGAACGCAAAGATGACTCAAATGAGAAC
TCCGCATCTCCTAGTAAAACCAAGCCTACTAATAAAGACAGCAATTTACTAGATGATGAA
GAAAAATTCGATGATGATATGGAAGATTTCTCAGACTTAAAATCACGTTTGCCTTTACCA
GAGGGTGTTCTACAAGTTAATTTAGGCATTCCAATTATAGTTGTTTGCAACAAGATTGAT
TTATTGCTGAGAGGTGATAAATCTTAGCTATTAGAATAAAACTTAGAGTTCATTTAAAAG
CATTTACGTTCGTACTGTTTGTCCTATGCAGCTACTCTGATGTTTACTGAATCAATTTAA
CAGACAAATATTGAGCTTCTCTATCGCTATATTCTGCACAGACTCTACGATTAAGAATTC
AATAATAAAGCTGAGATTCTTCAAAAAGATGCTATATTTATACCAACTGGGTTTGACAGT
TTAATGCTGATTGAAGCTCTGTGTAAGGGTGCTTATCAGGAAGGTAAAGTATATGAAGAA
ATAATTAAAAAGCCATCAGTTGCTCAATAAGGATAAAATAAGTCTGAAATTACTTGTGAA
GACTGGCAATCTCTATTATAGCGTTAATTCGGTATGAGACGTGCGGGTGGAGCTGGAGCA
GGAAGCTTAGGTTAATAATAACAACCTGGTCAGGCTGCAGGAGGTGCTGCTAATAAGCTT
GATGAAAAATAGAAGAAAGATATGACAGGATTTTTCCAAGGTTTAATAAATAAAGGATAG
AGATCTAAACCAGTTAGTGGTCCAGGTGCAAATGTTCCAGGAGAAAGAAGGATGCCTGCT
CAAGATTAAAATTAGAGTGCAGTTAATGGATAACTTTCAGGCGGAAGTGGGCTATCGTAA
AATAATCCATTAGCAAGAGCTTCACAAGCTTAAATGCAACAACAAAAGGATGGAGCAACT
TCTTAAGATATCTTATAATCATTAAGAGATAGGCACTCTGCTAAAGTACAGCCAAGTGGA
GGATTACCGTAGTAATTGCCCAGTGATAATCAACCATAGCAATAAGACGATTCCTAGTAA
TGA


>Contig11500.0.g38(protein)
MNMMDDSDVNGSSSRYGNMSPESRRGTQMERRDTVSGGGGISNSNQKIFNVIQKNILESG
QSNLWKAILNDVTQRDDIKESHLLVLGDRGAGKKSLISAVNKHIVRATNMLINVDKMGSQ
YSALDSAFLYVKDLSEKDALNENEQVLPCMNVWMLQEQDKADLIKQVIKPDDLQHTCALI
VLDFDQPWEMMNALQRWMGVLGETILDIMKLLKSSEQDKMKDRLTRFVKNFERKDDSNEN
SASPSKTKPTNKDSNLLDDEEKFDDDMEDFSDLKSRLPLPEGVLQVNLGIPIIVVCNKID
LLLRGDKSQLLEQNLEFIQKHLRSYCLSYAATLMFTESIQQTNIELLYRYILHRLYDQEF
NNKAEILQKDAIFIPTGFDSLMLIEALCKGAYQEGKVYEEIIKKPSVAQQGQNKSEITCE
DWQSLLQRQFGMRRAGGAGAGSLGQQQQPGQAAGGAANKLDEKQKKDMTGFFQGLINKGQ
RSKPVSGPGANVPGERRMPAQDQNQSAVNGQLSGGSGLSQNNPLARASQAQMQQQKDGAT
SQDILQSLRDRHSAKVQPSGGLPQQLPSDNQPQQQDDSQQ