Identifiers and Description

Gene Model Identifier

Contig11487.0.g49

Standard Name

None

Aliases

Contig11487_0_g49

Description

Partial alpha/beta-hydrolase lipase region

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005705405.000996804856152e-78ab-hydrolase associated lipase
region family ...
SGDYKL140W1.9991517704232713e-32TGL1 SGDID:S000001623, Chr XI
from 180779-182425, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11487.0.g49(coding)
ATGGGACTATTGGCGCTCAGTGGTTCTTGCTAAAATCAGATAATCTAAGGCAAAGTAGCT
AAAGTCCAATAAAATTCAGCTGATCCTGATGTATACAAGACTTTTCAACAAATTGTGGAA
GATAATGGATTTATATTTGAAGAGCATTTGGTCTACACTCCTGATAATTACACACTAAAG
GTTTTCAGAATACCTGCCCAAAAGATTAATGAACATGAAGTTAACTCTGGCAAGCCAGTT
GTATTTATGCAACACGGCCTTCTAGATTCAGCTGACTGCTGGATTATGAATCATGCGGAA
GTATCTCCAGCCTTTGTAGCATCAAGGGCTGGCTATGATGTGTGGCTCGGCAACAACAGG
GGTAATAAATACAGCCATCACTTGTACTCGGGAGAGAAAAGCAAACAACAATATTGGGAC
TTCAGCTTTTAAGAGATGGGTGATTTTGATATCCCTGCAATGATTCAATATGTCCTTAAT
GTTACCAATCAAGAGAAACTTGCCTACGCTGGTCATTCTCAAGGTACAACTTAGATGTTC
TATGCTCTTGCAACAAATGAAGAATTCTTAGCTTCAAGAGTCTCTGTCGTTTTGGCCTTT
GGTCCTGTTGCTTAATTGAACAATTCAACTTCAAAAATGGTTCAACTCTTTGCCTCAAAC
TTAACCAGAAAAGTGGTAGTGAACACTTGCAATGCTCTTGGAATGTATGAATGGTTCTCT
TCTAACTGGGTTACCACTGGTTCTATGAGACTTATTTGCGACACCTTCCCTAAAGTCTGT
GAATATGGAGTTTACCTGAACTCAGACAACAATCTCACAGATTGCGATGAGAAACGTATT
CAAGTATACCTCGGTCACTATCCCAGTGGATCCAGTTTGAAATCATTCGACCATCTTGGT
TAAATGCTTGATGATGGAAAGATGTAGAAGTTTGACTATGGAAAGAAGTAAAACCTTCAA
ATCTATGGCAATGAGCTACCCCCACTTATTGACTTAACTAAGATTAGCAAAGTTCCCATT
GGTTTGTTTGTAGGTTAATATGACGAGCTAGCTGATAAAACAGACGCTCAATGGCTTAAA
ACTTAACTAAAAACTTTGACTCATTATAAGGAATACGAATTGGGTCACTTGGCTTTCTTC
GTTGCCAAGGACATGAGTTATTTCACTCAGGATGCCATGAACTTGTTAATGAAGTATCAA
CCACTGAAATAAAATGCTTTTAAAACTTTCCTTCAATGA


>Contig11487.0.g49(protein)
MGLLALSGSCQNQIIQGKVAKVQQNSADPDVYKTFQQIVEDNGFIFEEHLVYTPDNYTLK
VFRIPAQKINEHEVNSGKPVVFMQHGLLDSADCWIMNHAEVSPAFVASRAGYDVWLGNNR
GNKYSHHLYSGEKSKQQYWDFSFQEMGDFDIPAMIQYVLNVTNQEKLAYAGHSQGTTQMF
YALATNEEFLASRVSVVLAFGPVAQLNNSTSKMVQLFASNLTRKVVVNTCNALGMYEWFS
SNWVTTGSMRLICDTFPKVCEYGVYLNSDNNLTDCDEKRIQVYLGHYPSGSSLKSFDHLG
QMLDDGKMQKFDYGKKQNLQIYGNELPPLIDLTKISKVPIGLFVGQYDELADKTDAQWLK
TQLKTLTHYKEYELGHLAFFVAKDMSYFTQDAMNLLMKYQPLKQNAFKTFLQ